Property Summary

NCBI Gene PubMed Count 35
Grant Count 30
Funding $16,649,322.44
PubMed Score 77.42
PubTator Score 58.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

PMID Text
26527274 A model of the ligand-binding region of uPARAP was obtained by molecular replacement.
26466547 Our findings identify sarcoma cell-resident uPARAP/Endo180 as a central player in the bone degeneration of advanced osteosarcoma
26284904 The positive correlation between suPLAUR expression and body mass index, suggests that leukocyte recruitment in obese tissue may be regulated, at least in part, through the splicing of the PLAUR transcript.
25408555 AGE-dependent modification of the basal lamina induces invasive behaviour in non-transformed prostate epithelial cells via Endo180 pathway linked to cancer progression.
25381222 Study identifies the interaction between lectin domain in Endo180 and CD147 as an Epithelial-to-mesenchymal transition suppressor and indicates that stabilization of this molecular complex improves prostate cancer survival rates.
24161566 MRC2 is downregulated by UVA irradiation and reduces collagen internalization; this can be recovered by all-trans retinoic acid
23433549 Our findings correlate for the first time impaired collagen uptake via Endo180 with the pericellular accumulation of collagen fragments during photoaging.
23148569 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
22132194 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
22072289 TGFbeta1-Endo180-dependent collagen deposition is dysregulated at the tumour-stromal interface in bone metastasis.
More...

AA Sequence

MGPGRPAPAPWPRHLLRCVLLLGCLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGGQVRVTPACNT      1 - 70
SLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGARTSN     71 - 140
ISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGH    141 - 210
LWCATTQDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIH    211 - 280
EQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRD    281 - 350
CSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI    351 - 420
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGR    421 - 490
WNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTIT    491 - 560
NRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLW    561 - 630
EVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQA    631 - 700
QGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYH    701 - 770
NFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF    771 - 840
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINF    841 - 910
ISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFL    911 - 980
NKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQ    981 - 1050
EPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPA   1051 - 1120
ALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGE   1121 - 1190
EGSRRYSWVSEEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGS   1191 - 1260
CPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWL   1261 - 1330
GMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWRPGACTNITMGVVCKLPRAEQ   1331 - 1400
SSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQSIERGAFEGARYSRSSSSPTEATEKNILVS   1401 - 1470
DMEMNEQQE                                                                1471 - 1479
//

Text Mined References (41)

PMID Year Title
26527274 2015 Expression and crystallographic studies of the ligand-binding region of the human endocytic collagen receptor uPARAP.
26466547 2016 Targeting a novel bone degradation pathway in primary bone cancer by inactivation of the collagen receptor uPARAP/Endo180.
26284904 2015 The mRNA expression of soluble urokinase plasminogen activator surface receptor in human adipose tissue is positively correlated with body mass index.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25408555 2015 AGE-modified basement membrane cooperates with Endo180 to promote epithelial cell invasiveness and decrease prostate cancer survival.
25381222 2015 Survival Outcome and EMT Suppression Mediated by a Lectin Domain Interaction of Endo180 and CD147.
24161566 2014 Reduced collagen internalization via down-regulation of MRC2 expression by UVA irradiation and its recovery by all-trans retinoic acid.
23433549 2013 UV-mediated downregulation of the endocytic collagen receptor, Endo180, contributes to accumulation of extracellular collagen fragments in photoaged skin.
22072289 2012 TGF?1-Endo180-dependent collagen deposition is dysregulated at the tumour-stromal interface in bone metastasis.
21768090 2011 A novel functional role of collagen glycosylation: interaction with the endocytic collagen receptor uparap/ENDO180.
More...