Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.03
PubTator Score 9.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 4.1e-09
cystic fibrosis 1696 1.5e-04
group 3 medulloblastoma 4104 1.9e-04
Rheumatoid arthritis 1191 1.4e-03
pituitary cancer 1972 2.3e-03
interstitial cystitis 2312 1.4e-02
Disease Target Count Z-score Confidence
Silver-Russell syndrome 39 5.555 2.8
Splenic marginal zone lymphoma 7 3.511 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 1.400 1.5e-04
group 3 medulloblastoma 2.300 1.9e-04
interstitial cystitis -1.200 1.4e-02
pituitary cancer 1.300 2.3e-03
Rheumatoid arthritis 1.700 1.4e-03
tuberculosis 1.800 4.1e-09

Protein-protein Interaction (4)

Gene RIF (2)

AA Sequence

MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAF      1 - 70
FAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTMLQAI     71 - 140
ERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINEAQEAASSDNIMVQYHALGVLYHLRKNDRLA    141 - 210
VSKMLNKFTKSGLKSQFAYCMLIRIASRLLKETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNC    211 - 280
TARELAPAVSVLQLFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLK    281 - 350
TGSESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC    351 - 420
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRVVLENEAVRAA    421 - 490
AVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEK    491 - 560
ALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKS    561 - 630
SEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQP    631 - 700
GICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFA    701 - 770
AAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVR    771 - 840
SRLALADGVTMQVTVRSKERTPVDVILASVG                                           841 - 871
//

Text Mined References (27)

PMID Year Title