Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 5
Funding $466,040.25
PubMed Score 10.79
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.001
group 3 medulloblastoma 2.300 0.000
tuberculosis 1.800 0.000
interstitial cystitis -1.200 0.014
cystic fibrosis 1.400 0.000
pituitary cancer 1.300 0.002

Gene RIF (2)

PMID Text
22456293 In cortices, the MEST promoter was hemimethylated, as expected for a differentially methylated imprinting control region, whereas the COPG2 and TSGA14 promoters were completely demethylated, typical for transcriptionally active non-imprinted genes.
11920156 Mutation sscreening and imprinting analysis of candidate genes for autism in the 7q32 region

AA Sequence

MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAF      1 - 70
FAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTMLQAI     71 - 140
ERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINEAQEAASSDNIMVQYHALGVLYHLRKNDRLA    141 - 210
VSKMLNKFTKSGLKSQFAYCMLIRIASRLLKETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNC    211 - 280
TARELAPAVSVLQLFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLK    281 - 350
TGSESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC    351 - 420
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRVVLENEAVRAA    421 - 490
AVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEK    491 - 560
ALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKS    561 - 630
SEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQP    631 - 700
GICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFA    701 - 770
AAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVR    771 - 840
SRLALADGVTMQVTVRSKERTPVDVILASVG                                           841 - 871
//

Text Mined References (27)

PMID Year Title
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22456293 2012 Methylation and expression analyses of the 7q autism susceptibility locus genes MEST , COPG2, and TSGA14 in human and anthropoid primate cortices.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729954 2004 Novel isotypic gamma/zeta subunits reveal three coatomer complexes in mammals.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...