Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.02
PubTator Score 26.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Cold-induced sweating syndrome 1 2
Disease Target Count P-value
malignant mesothelioma 3163 3.87547063765121E-6
non diabetic and post-ischemic heart failure 200 0.0124014679805861
Disease Target Count Z-score Confidence
cold-induced sweating syndrome 6 6.544 3.3
Disease Target Count Z-score Confidence
Scoliosis 40 3.441 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
non diabetic and post-ischemic heart fai... -1.100 0.012

Synonym

Accession Q9UBD9 B4DNT4 Q6NZA4
Symbols CLC
NR6
BSF3
NNT1
BSF-3
CISS2
NNT-1

Gene

  Ortholog (10)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26858303 CLF-1, based on its binding site for CLC and on two additional and independent sites for CNTFRalpha and sorLA, is a key player in CLC and CNTFRalpha signaling and turnover.
26198769 Cardiotrophin-like cytokine factor 1 (CLCF1) and neuropoietin (NP) signalling and their roles in development, adulthood, cancer and degenerative disorders.
25843671 albuminuria in focal segmental glomerulosclerosis is related to qualitative or quantitative changes in the CLCF1-CRLF1 complex.
18728012 Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain
16782820 Structural and docking interaction studies showed that the R197L substitution destabilized the contact site between CLC and CNTFRalpha.
12639901 activation of the Jak-STAT cascade is essential for corticotroph NNT-1/BSF-3 signaling.

AA Sequence

MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFN      1 - 70
EPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSL     71 - 140
QGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQ    141 - 210
PPAAAVTLHLGAHGF                                                           211 - 225
//

Text Mined References (20)

PMID Year Title
26858303 2016 Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor ? Signaling and sorLA-Mediated Turnover.
26198769 2015 Cardiotrophin-like cytokine factor 1 (CLCF1) and neuropoietin (NP) signalling and their roles in development, adulthood, cancer and degenerative disorders.
25843671 2015 Janus kinase 2/signal transducer and activator of transcription 3 inhibitors attenuate the effect of cardiotrophin-like cytokine factor 1 and human focal segmental glomerulosclerosis serum on glomerular filtration barrier.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18728012 2008 Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain.
17436251 2007 Mutations in cytokine receptor-like factor 1 (CRLF1) account for both Crisponi and cold-induced sweating syndromes.
16782820 2006 Inactivation of cardiotrophin-like cytokine, a second ligand for ciliary neurotrophic factor receptor, leads to cold-induced sweating syndrome in a patient.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...