Property Summary

NCBI Gene PubMed Count 30
Grant Count 57
R01 Count 25
Funding $5,289,389.24
PubMed Score 85.29
PubTator Score 47.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q9UBC0 B2RTV4 Q99744 Q9UMR6 HNF-6
Symbols HNF6
HNF-6
HNF6A

Gene

Gene RIF (18)

PMID Text
26825606 Reduced HNF6 expression is associated with metastasis of cholangiocarcinoma.
25653429 HNF6 is a novel host factor that can restrict hepatitis B virus replication via both transcriptional and posttranscriptional mechanisms.
24638272 The negative correlation between HNF6 expression and pancreatic cancer progression suggests that HNF6 maintains pancreatic epithelial homeostasis, and that its loss contributes to the progression from intraepithelial neoplasms to ductal adenocarcinoma.
24022481 HNF6 inhibits EMT, cell migration, and invasive growth through a mechanism involving the transcriptional activation of p53.
23472758 Mutations at the -5/-6 site of the F9 promotor account for the majority of hemophilia B Leyden cases and disrupt the binding of ONECUT1 and ONECUT2.
23291635 HNF6 plays an important role in the gene regulation of CYP3A4 during development from the fetal period to the postnatal period.
22271799 HNF6 and Sox9 are new biomarkers of pancreatic acinar-to-ductal metaplasia and constitute candidate targets for preventive treatment in cases when acinar-to-ductal metaplasia may lead to cancer.
21893194 Hepatocyte nuclear factor 6 is one of the liver-enriched transcription factors, it utilizes the bipartite onecut-homeodomain sequence to localize to the nuclear compartment and bind specific DNA sequences of numerous target gene promoters
20967225 functional knockdown of FOXA2 recovered HNF6 activity and inhibited growth of tumor-cells and may possibly represent a novel therapeutic target in primary and secondary liver malignancies
18976975 Knockdown of one cut homeobox 1 (ONECUT1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLDGGSGGGDYHH      1 - 70
HHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHHHHHHHPHHHQR     71 - 140
LAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTD    141 - 210
KMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQV    211 - 280
SNGSNSGQMEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRM    281 - 350
WKWLQEPEFQRMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ    351 - 420
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA                             421 - 465
//

Text Mined References (31)

PMID Year Title
26825606 2016 Hepatocyte nuclear factor 6 inhibits the growth and metastasis of cholangiocarcinoma cells by regulating miR-122.
25653429 2015 Inhibition of hepatitis B virus gene expression and replication by hepatocyte nuclear factor 6.
24638272 2014 Loss of HNF6 expression correlates with human pancreatic cancer progression.
24022481 2013 Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition.
23472758 2013 A CpG mutational hotspot in a ONECUT binding site accounts for the prevalent variant of hemophilia B Leyden.
23291635 2013 Hepatocyte nuclear factor 6 activates the transcription of CYP3A4 in hepatocyte-like cells differentiated from human induced pluripotent stem cells.
22271799 2012 Role of the ductal transcription factors HNF6 and Sox9 in pancreatic acinar-to-ductal metaplasia.
21920465 2012 A feedback loop between the liver-enriched transcription factor network and miR-122 controls hepatocyte differentiation.
21893194 2012 Pathophysiologic role of hepatocyte nuclear factor 6.
20967225 2010 Inhibition of the liver enriched protein FOXA2 recovers HNF6 activity in human colon carcinoma and liver hepatoma cells.
More...