Property Summary

NCBI Gene PubMed Count 32
PubMed Score 90.15
PubTator Score 47.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
maturity-onset diabetes of the young 32 3.7 1.8
Cholestasis 155 3.176 1.6

Expression

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLDGGSGGGDYHH      1 - 70
HHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHHHHHHHPHHHQR     71 - 140
LAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTD    141 - 210
KMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQV    211 - 280
SNGSNSGQMEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRM    281 - 350
WKWLQEPEFQRMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ    351 - 420
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA                             421 - 465
//

Text Mined References (33)

PMID Year Title