Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9P2X8 Q08EI2
Symbols C9orf27
EST-YD1

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
21184217 Cells with deletions of either histidine kinase gene cyd1 or cyd2 fail to form cysts and exhibit altered swarming behavior.
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLCVSGFTSNLYSSKKDDKMKEISRTSNWGSSFSEKSGCMQTHPSMNLDCRDVTYVMNLLLIAHHHLLQ       1 - 69
//

Text Mined References (6)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
21184217 2011 Two putative histidine kinases are required for cyst formation in Rhodospirillum Centenum.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10492169 1999 Significant differences in the frequency of transcriptional units, types and numbers of repetitive elements, GC content, and the number of CpG islands between a 1010-kb G-band genomic segment on chromosome 9q31.3 and a 1200-kb R-band genomic segment on chromosome 3p21.3.