Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9P2X8 Q08EI2
Symbols C9orf27
EST-YD1

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MLCVSGFTSNLYSSKKDDKMKEISRTSNWGSSFSEKSGCMQTHPSMNLDCRDVTYVMNLLLIAHHHLLQ       1 - 69
//

Text Mined References (5)

PMID Year Title