Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Disease Target Count
Chronic Lymphocytic Leukemia 262
Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 44 3.533 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 1.1e-02
lung cancer -1.800 4.7e-05
non-small cell lung cancer -1.108 2.6e-20
osteosarcoma -1.518 7.8e-05
primary Sjogren syndrome 1.200 7.6e-03
tuberculosis 1.100 1.7e-05

AA Sequence

MGRTWCGMWRRRRPGRRSAVPRWPHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAAAQPSAHGALV      1 - 70
PPATAHEPVDHPALHWLACCCCLSLPGQLPLAIRLGWDLDLEAGPSSGKLCPRARRWQPLPS             71 - 132
//

Text Mined References (6)

PMID Year Title