Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
chronic lymphocytic leukemia 244
Disease Target Count P-value
non-small cell lung cancer 2798 2.55944664022715E-20
tuberculosis 1563 3.25104211583528E-8
osteosarcoma 7933 1.30719504868889E-5
lung cancer 4473 4.68992265712165E-5
primary Sjogren syndrome 789 0.00759316569221179
cutaneous lupus erythematosus 1056 0.0114882982737774
Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 46 3.506 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.011
osteosarcoma -3.478 0.000
tuberculosis 3.100 0.000
non-small cell lung cancer -1.108 0.000
lung cancer -1.800 0.000
primary Sjogren syndrome 1.200 0.008

AA Sequence

MGRTWCGMWRRRRPGRRSAVPRWPHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAAAQPSAHGALV      1 - 70
PPATAHEPVDHPALHWLACCCCLSLPGQLPLAIRLGWDLDLEAGPSSGKLCPRARRWQPLPS             71 - 132
//

Text Mined References (6)

PMID Year Title
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11054561 2000 C11orf21, a novel gene within the Beckwith-Wiedemann syndrome region in human chromosome 11p15.5.