Property Summary

NCBI Gene PubMed Count 29
Grant Count 1,060
R01 Count 629
Funding $137,316,469.15
PubMed Score 83.31
PubTator Score 26.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma -1.986 0.000
astrocytoma 1.500 0.003
atypical teratoid / rhabdoid tumor 1.100 0.020
group 4 medulloblastoma 1.700 0.006
medulloblastoma, large-cell 1.500 0.000
tuberculosis and treatment for 3 months 1.300 0.000
lung cancer 2.200 0.000
Breast cancer -2.700 0.029
subependymal giant cell astrocytoma -2.129 0.007
ulcerative colitis -1.100 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q9P2R6 O43393 O75046 O75359 Q5VXL9 Q6P6B9 Q9Y2W4
Symbols ARG
ARP
DNB1
ATN1L
NEDBEH

Gene

PDB

2YQK  

Gene RIF (4)

PMID Text
20410501 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18597038 Observational study of gene-disease association. (HuGE Navigator)
14645126 The mouse ortholog of RERE is required for embryonic development

AA Sequence

MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNYAESDHSEDEDNDNNSATAEE      1 - 70
STKKNKKKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNTPYFICSIQDFKLVHNSQACC     71 - 140
RSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEVPDSVYQHLVQDRHNEND    141 - 210
SGRELVITDPVIKNRELFISDYVDTYHAAALRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLN    211 - 280
STQGEIRVGPSHQAKLPDLQPFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTE    281 - 350
DGCVAASRDDTTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRK    351 - 420
ELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSSEFLDLSSASE    421 - 490
DDFDSEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYGELPPIEKPVDPPPFMFKPVK    491 - 560
EEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTSPINEDIRSSGRNSPSAASTSSNDSKAETVK    561 - 630
KSAKKVKEEASSPLKSNKRQREKVASDTEEADRTSSKKTKTQEISRPNSPSEGEGESSDSRSVNDEGSSD    631 - 700
PKDIDQDNRSTSPSIPSPQDNESDSDSSAQQQMLQAQPPALQAPTGVTPAPSSAPPGTPQLPTPGPTPSA    701 - 770
TAVPPQGSPTASQAPNQPQAPTAPVPHTHIQQAPALHPQRPPSPHPPPHPSPHPPLQPLTGSAGQPSAPS    771 - 840
HAQPPLHGQGPPGPHSLQAGPLLQHPGPPQPFGLPPQASQGQAPLGTSPAAAYPHTSLQLPASQSALQSQ    841 - 910
QPPREQPLPPAPLAMPHIKPPPTTPIPQLPAPQAHKHPPHLSGPSPFSMNANLPPPPALKPLSSLSTHHP    911 - 980
PSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQNLPPPPASHPPTGLHQVAPQPPFAQHPFVPGGPPPITPP    981 - 1050
TCPSTSTPPAGPGTSAQPPCSGAAASGGSIAGGSSCPLPTVQIKEEALDDAEEPESPPPPPRSPSPEPTV   1051 - 1120
VDTPSHASQSARFYKHLDRGYNSCARTDLYFMPLAGSKLAKKREEAIEKAKREAEQKAREEREREKEKEK   1121 - 1190
EREREREREREAERAAKASSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYA   1191 - 1260
RPHVMSPTNRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELRERMKPGFEVK   1261 - 1330
PPELDPLHPAANPMEHFARHSALTIPPTAGPHPFASFHPGLNPLERERLALAGPQLRPEMSYPDRLAAER   1331 - 1400
IHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGSAGPVHPLVDPLTAGPHLARFPY   1401 - 1470
PPGTLPNPLLGQPPHEHEMLRHPVFGTPYPRDLPGAIPPPMSAAHQLQAMHAQSAELQRLAMEQQWLHGH   1471 - 1540
PHMHGGHLPSQEDYYSRLKKEGDKQL                                               1541 - 1566
//

Text Mined References (37)

PMID Year Title
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...