Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.64
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis 1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9P2M4 B9A6L5 D3DVT4 E9PAZ6 Q8IW15 Q8NDK3
Symbols

Gene

PANTHER Protein Class (2)

PDB

2QQ8  

Gene RIF (4)

PMID Text
26711178 TRAPPC8 modulates autophagy and secretory trafficking and is required for TBC1D14 to bind TRAPPIII.
22613832 TBC1D14 binds activated Rab11 but is not a GAP for Rab11, and loss of Rab11 prevents TBC1D14-induced tubulation of recycling endosomes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18186464 crystal structures of the first two mammalian TBCs, human TBC1 family members 22A (TBC1D22A) and 14 (TBC1D14)

AA Sequence

MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRHSLQSVDSGIPT      1 - 70
LEIGNPEPVPCSAVHVRRKQSDSDLIPERAFQSACALPSCAPPAPSSTEREQSVRKSSTFPRTGYDSVKL     71 - 140
YSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDPQFTNVTLSSIKE    141 - 210
TRGLHQQDCVHEAEEGSKLKILGPFSNFFARNLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQ    211 - 280
KEYEDKAGRPSKPPSPKQNVRKNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKREL    281 - 350
KEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELN    351 - 420
ITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCIFQQGGPYHDML    421 - 490
HSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVF    491 - 560
FEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDIL    561 - 630
TKMDFIHMAQFLTRLPEDLPAEELFASIATIQMQSRNKKWAQVLTALQKDSREMEKGSPSLRH           631 - 693
//

Text Mined References (17)

PMID Year Title
26711178 2016 TBC1D14 regulates autophagy via the TRAPP complex and ATG9 traffic.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22613832 2012 TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18186464 2008 First crystallographic models of human TBC domains in the context of a family-wide structural analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
More...