Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.45
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.1e-07
atypical teratoid / rhabdoid tumor 1.500 5.8e-09
Breast cancer 2.700 2.4e-02
ependymoma 1.100 7.4e-03
group 4 medulloblastoma 1.800 8.6e-07
hepatocellular carcinoma 1.200 3.0e-05
medulloblastoma, large-cell 1.200 3.1e-04
ovarian cancer -1.700 1.7e-04
primitive neuroectodermal tumor 1.500 8.8e-06
tuberculosis and treatment for 6 months -1.100 5.4e-06

Protein-protein Interaction (12)

Gene RIF (2)

AA Sequence

MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMM      1 - 70
ASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDF     71 - 140
CKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHC    141 - 210
TELELFKAACRWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMP    211 - 280
YMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLY    281 - 350
VVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYN    351 - 420
PRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWMQKAPMTTVRGLHCMCT    421 - 490
VGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCM    491 - 560
VEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS                 561 - 617
//

Text Mined References (13)

PMID Year Title