Property Summary

NCBI Gene PubMed Count 34
Grant Count 14
R01 Count 13
Funding $1,020,315.61
PubMed Score 9.98
PubTator Score 9.36

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (6)

PMID Text
26148673 CPSF2 may have a role in Papillary Thyroid Carcinoma
25921069 CPSF2 and SYMPK, are RBFOX2 cofactors for both inclusion and exclusion of internal exons.
24654752 Decreased CPSF2 expression is associated with increased cellular invasion and cancer stem cell population, and more aggressive disease in papillary thyroid cancer.
22174317 HIV-1 Rev interacting protein, cleavage and polyadenylation specific factor 2 (CPSF2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CPSF2 is increased by RRE
20546612 Observational study of gene-disease association. (HuGE Navigator)
18688255 Conserved residues in CPSF2 and CPSF-73 are required for assembly of the endonuclease activity that cleaves histone pre-mRNAs.

AA Sequence

MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLLSHPDPLHLGA      1 - 70
LPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAAFDKIQQLKFSQIVNLKGK     71 - 140
GHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNHKREIHLNGCSLEMLSRPSLLITDSFNATYVQP    141 - 210
RRKQRDEQLLTNVLETLRGDGNVLIAVDTAGRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFS    211 - 280
KSQVEWMSDKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPK    281 - 350
NSIILTYRTTPGTLARFLIDNPSEKITEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSS    351 - 420
DESDIEEDIDQPSAHKTKHDLMMKGEGSRKGSFFKQAKKSYPMFPAPEERIKWDEYGEIIKPEDFLVPEL    421 - 490
QATEEEKSKLESGLTNGDEPMDQDLSDVPTKCISTTESIEIKARVTYIDYEGRSDGDSIKKIINQMKPRQ    491 - 560
LIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDATSETHIYQVRLKDSLVSSLQFCKAKDAELAW    561 - 630
IDGVLDMRVSKVDTGVILEEGELKDDGEDSEMQVEAPSDSSVIAQQKAMKSLFGDDEKETGEESEIIPTL    631 - 700
EPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYR    701 - 770
IRDLLYEQYAIV                                                              771 - 782
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26148673 2015 Negative Expression of CPSF2 Predicts a Poorer Clinical Outcome in Patients with Papillary Thyroid Carcinoma.
25921069 2015 Global Promotion of Alternative Internal Exon Usage by mRNA 3' End Formation Factors.
24654752 2014 Loss of CPSF2 expression is associated with increased thyroid cancer cellular invasion and cancer stem cell population, and more aggressive disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
21102410 2010 The poly A polymerase Star-PAP controls 3'-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA.
More...