Property Summary

NCBI Gene PubMed Count 35
PubMed Score 10.14
PubTator Score 9.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.095 1.7e-04
aldosterone-producing adenoma -1.300 1.5e-02
atypical teratoid / rhabdoid tumor 1.300 1.8e-07
Breast cancer 2.000 3.0e-02
ependymoma 1.500 4.6e-13
glioblastoma 1.100 2.0e-05
group 4 medulloblastoma 1.300 1.4e-05
hepatocellular carcinoma 1.400 4.1e-05
medulloblastoma, large-cell 1.700 2.5e-05
ovarian cancer -2.100 1.1e-06
pancreatic cancer 1.100 8.0e-03
pancreatic carcinoma 1.100 8.0e-03
pancreatic ductal adenocarcinoma liver m... -1.018 3.4e-02
pediatric high grade glioma 1.200 1.5e-07
primitive neuroectodermal tumor 1.100 8.0e-04

Synonym

Accession Q9P2I0 B3KME1 Q6NSJ1 Q9H3W7
Symbols CPSF100

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (6)

AA Sequence

MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLLSHPDPLHLGA      1 - 70
LPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAAFDKIQQLKFSQIVNLKGK     71 - 140
GHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNHKREIHLNGCSLEMLSRPSLLITDSFNATYVQP    141 - 210
RRKQRDEQLLTNVLETLRGDGNVLIAVDTAGRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFS    211 - 280
KSQVEWMSDKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPK    281 - 350
NSIILTYRTTPGTLARFLIDNPSEKITEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSS    351 - 420
DESDIEEDIDQPSAHKTKHDLMMKGEGSRKGSFFKQAKKSYPMFPAPEERIKWDEYGEIIKPEDFLVPEL    421 - 490
QATEEEKSKLESGLTNGDEPMDQDLSDVPTKCISTTESIEIKARVTYIDYEGRSDGDSIKKIINQMKPRQ    491 - 560
LIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDATSETHIYQVRLKDSLVSSLQFCKAKDAELAW    561 - 630
IDGVLDMRVSKVDTGVILEEGELKDDGEDSEMQVEAPSDSSVIAQQKAMKSLFGDDEKETGEESEIIPTL    631 - 700
EPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYR    701 - 770
IRDLLYEQYAIV                                                              771 - 782
//

Text Mined References (42)

PMID Year Title