Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 1.6e-02
lung carcinoma 1.300 1.2e-27
osteosarcoma 1.039 1.3e-03
ovarian cancer -1.300 3.8e-04
posterior fossa group B ependymoma -1.100 2.3e-05

Gene RIF (1)

AA Sequence

MGAAPSPTQASSRGGGPGPPAPTRAVSSSSRARGGALSALGPSPARPLTTSPAPAPPPRSRPARQQPDPQ      1 - 70
CWEKRGGAGGDTKGGAAGPGPGRLRGMDAEYPAFEPPLCSELKHLCRRLREAYRELKEDLTPFKDDRYYR     71 - 140
LAPMRLYTLSKRHFVLVFVVFFICFGLTIFVGIRGPKVIQTSAANFSLNNSKKLKPIQILSNPLSTYNQQ    141 - 210
LWLTCVVELDQSKETSIKTSFPMTVKVDGVAQDGTTMYIHNKVHNRTRTLTCAGKCAEIIVAHLGYLNYT    211 - 280
QYTVIVGFEHLKLPIKGMNFTWKTYNPAFSRLEIWFRFFFVVLTFIVTCLFAHSLRKFSMRDWGIEQKWM    281 - 350
SVLLPLLLLYNDPFFPLSFLVNSWLPGMLDDLFQSMFLCALLLFWLCVYHGIRVQGERKCLTFYLPKFFI    351 - 420
VGLLWLASVTLGIWQTVNELHDPMYQYRVDTGNFQGMKVFFMVVAAVYILYLLFLIVRACSELRHMPYVD    421 - 490
LRLKFLTALTFVVLVISIAILYLRFGAQVLQDNFVAELSTHYQNSAEFLSFYGLLNFYLYTLAFVYSPSK    491 - 560
NALYESQLKDNPAFSMLNDSDDDVIYGSDYEEMPLQNGQAIRAKYKEESDSD                      561 - 612
//

Text Mined References (13)

PMID Year Title