Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.039 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.016
posterior fossa group B ependymoma -1.100 0.000
lung carcinoma 1.300 0.000
ovarian cancer 1.600 0.003

Gene RIF (1)

PMID Text
18187620 Knockdown of transmembrane protein 181 (TMEM181) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGAAPSPTQASSRGGGPGPPAPTRAVSSSSRARGGALSALGPSPARPLTTSPAPAPPPRSRPARQQPDPQ      1 - 70
CWEKRGGAGGDTKGGAAGPGPGRLRGMDAEYPAFEPPLCSELKHLCRRLREAYRELKEDLTPFKDDRYYR     71 - 140
LAPMRLYTLSKRHFVLVFVVFFICFGLTIFVGIRGPKVIQTSAANFSLNNSKKLKPIQILSNPLSTYNQQ    141 - 210
LWLTCVVELDQSKETSIKTSFPMTVKVDGVAQDGTTMYIHNKVHNRTRTLTCAGKCAEIIVAHLGYLNYT    211 - 280
QYTVIVGFEHLKLPIKGMNFTWKTYNPAFSRLEIWFRFFFVVLTFIVTCLFAHSLRKFSMRDWGIEQKWM    281 - 350
SVLLPLLLLYNDPFFPLSFLVNSWLPGMLDDLFQSMFLCALLLFWLCVYHGIRVQGERKCLTFYLPKFFI    351 - 420
VGLLWLASVTLGIWQTVNELHDPMYQYRVDTGNFQGMKVFFMVVAAVYILYLLFLIVRACSELRHMPYVD    421 - 490
LRLKFLTALTFVVLVISIAILYLRFGAQVLQDNFVAELSTHYQNSAEFLSFYGLLNFYLYTLAFVYSPSK    491 - 560
NALYESQLKDNPAFSMLNDSDDDVIYGSDYEEMPLQNGQAIRAKYKEESDSD                      561 - 612
//

Text Mined References (13)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19965467 2009 Haploid genetic screens in human cells identify host factors used by pathogens.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16452613 2006 A general model of G protein-coupled receptor sequences and its application to detect remote homologs.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...