Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.12
PubTator Score 13.46

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (8)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of prostaglandin F2 receptor inhibitor (PTGFRN) in peptide-treated PBMCs
21206492 These findings show for the first time that CD9P-1 expression positively correlates with the metastatic status of human lung tumor
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19703604 Tetraspanins can play a role on CD9P-1 oligomerization status.
17960739 CD9P-1 was shown to exhibit more than 40 different N-glycans, essentially composed of complex and high mannose-type structures.
17407154 transferrin receptor and CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells
16690612 EWI-2 and EWI-F link the tetraspanin web to the actin cytoskeleton through their direct association with ezrin-radixin-moesin proteins
16537545 EWI proteins EWI-2 and EWI-F, alpha3beta1 and alpha6beta4 integrins, and protein palmitoylation have contrasting effects on cell surface CD9 organization

AA Sequence

MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDYDGPSEQNFDWSFSSLGSSFVEL      1 - 70
ASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCSTPSTDATVQGNYEDTVQVKV     71 - 140
LADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTHLALLWEVHRGPARRSVLALTHEGRFHPGLG    141 - 210
YEQRYHSGDVRLDTVGSDAYRLSVSRALSADQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPSVLR    211 - 280
AAVPKNVSVAEGKELDLTCNITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSH    281 - 350
VDARSYHLLVRDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGF    351 - 420
ADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIF    421 - 490
SKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDVFSKPVNIFWALEDSVLVVKARQPKPF    491 - 560
FAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGDLSSPNETKYIISLDQDSVVKLENWTDASRVDGVVL    561 - 630
EKVQEDEFRYRMYQTQVSDAGLYRCMVTAWSPVRGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTPS    631 - 700
VIRGDLIKLFCIITVEGAALDPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLER    701 - 770
VSVLEFLLQVHGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLS    771 - 840
TVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD                                   841 - 879
//

Text Mined References (23)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
21206492 2011 CD9P-1 expression correlates with the metastatic status of lung cancer, and a truncated form of CD9P-1, GS-168AT2, inhibits in vivo tumour growth.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19703604 2009 In situ chemical cross-linking on living cells reveals CD9P-1 cis-oligomer at cell surface.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17960739 2007 Glycosylation status of the membrane protein CD9P-1.
17407154 2007 The transferrin receptor and the tetraspanin web molecules CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16690612 2006 EWI-2 and EWI-F link the tetraspanin web to the actin cytoskeleton through their direct association with ezrin-radixin-moesin proteins.
16537545 2006 Contrasting effects of EWI proteins, integrins, and protein palmitoylation on cell surface CD9 organization.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11673522 2001 PGRL is a major CD81-associated protein on lymphocytes and distinguishes a new family of cell surface proteins.
11278880 2001 The major CD9 and CD81 molecular partner. Identification and characterization of the complexes.
11087758 2001 FPRP, a major, highly stoichiometric, highly specific CD81- and CD9-associated protein.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
9643346 1998 Synthesis and accumulation of a receptor regulatory protein associated with lipid droplet accumulation in 3T3-L1 cells.
8804121 1996 Negative regulatory activity of a prostaglandin F2 alpha receptor associated protein (FPRP).
8655148 1996 Human chromosome 1 localization of the gene for a prostaglandin F2alpha receptor negative regulatory protein.