Property Summary

NCBI Gene PubMed Count 40
Grant Count 30
R01 Count 25
Funding $2,050,690.63
PubMed Score 63.30
PubTator Score 51.22

Knowledge Summary

Patent (4,003)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 2.010 0.017

Gene RIF (31)

PMID Text
26283482 this study reveals a novel role for C5aR2 in C5a-mediated activation of mast cells and demonstrates that C5aR2 ligation initiates a beta-arrestin-2-, PI3K-, and ERK-dependent signaling pathway in these cells.
25935173 All the C698T genotypes and allele frequencies in C5L2 were almost similar in both the cases and controls.
25726869 C5AR and C5L2-mediated neutrophil dysfunction is associated with a poor outcome in sepsis.
24885523 The present study has extended the mutation spectrum of C5L2, and Thr196Asn mutations in C5L2 were associated with retinitis pigmentosa and serum lipid levels.
24819959 prominent C5L2 expression in advanced atherosclerotic stages directly correlates with high levels of proinflammatory cytokines
24777312 C5a2 can modulate ERK1/2 signaling in macrophages via heteromer formation with C5a1 and beta-arrestin recruitment.
24523571 C5aR and C5L2 may have roles in adiposity in women
24078164 our study indicates that 698C>T polymorphism of C5L2 gene is associated with the T2DM in individuals of Saudi population which was found to be similar with other studies.
24073849 A novel polymorphism (901G > a) of C5L2 gene is associated with coronary artery disease in Chinese Han and Uyghur population.
23785491 C5L2 may be implicated in the pro-inflammatory role in C5a-primed neutrophils for ANCA-induced activation.
More...

AA Sequence

MGNDSVSYEYGDYSDLSDRPVDCLDGACLAIDPLRVAPLPLYAAIFLVGVPGNAMVAWVAGKVARRRVGA      1 - 70
TWLLHLAVADLLCCLSLPILAVPIARGGHWPYGAVGCRALPSIILLTMYASVLLLAALSADLCFLALGPA     71 - 140
WWSTVQRACGVQVACGAAWTLALLLTVPSAIYRRLHQEHFPARLQCVVDYGGSSSTENAVTAIRFLFGFL    141 - 210
GPLVAVASCHSALLCWAARRCRPLGTAIVVGFFVCWAPYHLLGLVLTVAAPNSALLARALRAEPLIVGLA    211 - 280
LAHSCLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSEMEV                 281 - 337
//

Text Mined References (43)

PMID Year Title
26283482 2015 The Novel Receptor C5aR2 Is Required for C5a-Mediated Human Mast Cell Adhesion, Migration, and Proinflammatory Mediator Production.
25935173 2015 Genetic polymorphisms in paraoxonase 1 and G protein-coupled receptor 77, and the risk of glucose-6-phosphate dehydrogenase deficiency in a Saudi population.
25726869 2016 Complement 5a receptor-mediated neutrophil dysfunction is associated with a poor outcome in sepsis.
24885523 2014 A novel mutation in C5L2 gene was associated with hyperlipidemia and retinitis pigmentosa in a Chinese family.
24819959 2014 High expression of C5L2 correlates with high proinflammatory cytokine expression in advanced human atherosclerotic plaques.
24777312 2014 C5a2 can modulate ERK1/2 signaling in macrophages via heteromer formation with C5a1 and ?-arrestin recruitment.
24523571 2014 Association of immune and metabolic receptors C5aR and C5L2 with adiposity in women.
24078164 2013 Circulating C5L2 gene polymorphism is associated with type 2 diabetes mellitus in Saudi population.
24073849 2013 A novel polymorphism (901G > a) of C5L2 gene is associated with coronary artery disease in Chinese Han and Uyghur population.
23785491 2013 A pro-inflammatory role of C5L2 in C5a-primed neutrophils for ANCA-induced activation.
More...