Property Summary

NCBI Gene PubMed Count 42
PubMed Score 70.54
PubTator Score 51.22

Knowledge Summary

Patent (4,003)

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 2.010 1.7e-02

Gene RIF (33)

AA Sequence

MGNDSVSYEYGDYSDLSDRPVDCLDGACLAIDPLRVAPLPLYAAIFLVGVPGNAMVAWVAGKVARRRVGA      1 - 70
TWLLHLAVADLLCCLSLPILAVPIARGGHWPYGAVGCRALPSIILLTMYASVLLLAALSADLCFLALGPA     71 - 140
WWSTVQRACGVQVACGAAWTLALLLTVPSAIYRRLHQEHFPARLQCVVDYGGSSSTENAVTAIRFLFGFL    141 - 210
GPLVAVASCHSALLCWAARRCRPLGTAIVVGFFVCWAPYHLLGLVLTVAAPNSALLARALRAEPLIVGLA    211 - 280
LAHSCLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSEMEV                 281 - 337
//

Text Mined References (45)

PMID Year Title