Property Summary

NCBI Gene PubMed Count 41
PubMed Score 26.37
PubTator Score 22.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cyst 2 4.02 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma 1.096 3.4e-03
group 3 medulloblastoma 1.300 1.1e-03
juvenile dermatomyositis 1.153 9.2e-11
lung cancer 1.100 5.6e-04
osteosarcoma -2.104 9.6e-04
ovarian cancer 2.100 3.1e-05
subependymal giant cell astrocytoma 1.713 9.2e-03

Gene RIF (21)

AA Sequence

MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND      1 - 70
YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ     71 - 140
CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN    141 - 210
KPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW    211 - 280
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV                                        281 - 314
//

Text Mined References (47)

PMID Year Title