Property Summary

NCBI Gene PubMed Count 37
Grant Count 37
R01 Count 31
Funding $2,842,809.39
PubMed Score 22.69
PubTator Score 22.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.104 0.001
juvenile dermatomyositis 1.153 0.000
adrenocortical carcinoma 1.096 0.003
lung cancer 1.100 0.001
group 3 medulloblastoma 1.500 0.003
subependymal giant cell astrocytoma 1.713 0.009
ovarian cancer 2.100 0.000

Gene RIF (17)

PMID Text
25150171 The BCCIPbeta, but not BCCIPalpha, interacts with EIF6 and RPL23/UL14 and stabilizes the latter.
23911796 Results indicate that BCCIP germ line mutations are unlikely to be a major contributor to familial breast/ovarian cancer risk in our population.
19861517 Observational study of gene-disease association. (HuGE Navigator)
19713748 regulation of p21 intracellular distribution is a new mechanism for BCCIP to modulate p21 functions
19653894 BCCIP protein expression was not detectable in approximately 45% of all astrocytic tumors.
19578363 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18773424 BCCIP is phosphorylated by the Src tyrosine kinase and dephosphorylated by the PTPmu tyrosine phosphatase; neurite outgrowth assays suggest that BCCIP and PTPmu are in a common signal transduction pathway.
18440304 LYRIC/AEG-1 is a negative regulator of BCCIPalpha, promoting proteasomal degradation either through direct interaction, or potentially through an indirect mechanism involving downstream effects of the NF-kappaB signaling pathway.
18413737 BCCIP-dependent repair of double strand breaks by homologous recombination is an early RAD51 response to ionizing radiation-induced DNA damage.
More...

AA Sequence

MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND      1 - 70
YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ     71 - 140
CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN    141 - 210
KPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW    211 - 280
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV                                        281 - 314
//

Text Mined References (43)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25150171 2014 The beta-isoform of the BRCA2 and CDKN1A(p21)-interacting protein (BCCIP) stabilizes nuclear RPL23/uL14.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911796 2013 Mutation analysis of the BCCIP gene for breast cancer susceptibility in breast/ovarian cancer families.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19861517 2009 Predisposition for TMPRSS2-ERG fusion in prostate cancer by variants in DNA repair genes.
19713748 2009 BCCIP is required for the nuclear localization of the p21 protein.
More...