Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.03
PubTator Score 10.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
nephrosclerosis 1.344 5.4e-04
malignant mesothelioma -8.400 2.3e-10
astrocytic glioma -2.100 3.0e-03
ependymoma -2.100 5.8e-03
oligodendroglioma -1.300 2.2e-02
psoriasis -1.800 2.0e-04
glioblastoma -2.300 1.4e-04
osteosarcoma -1.880 1.5e-02
cystic fibrosis 1.885 8.3e-06
atypical teratoid / rhabdoid tumor -2.500 2.7e-05
group 4 medulloblastoma -2.100 1.1e-03
medulloblastoma, large-cell -2.400 4.4e-03
primitive neuroectodermal tumor -2.000 1.9e-03
non-small cell lung cancer -1.933 2.0e-15
intraductal papillary-mucinous adenoma (... -2.600 2.6e-05
intraductal papillary-mucinous carcinoma... -2.600 5.1e-05
intraductal papillary-mucinous neoplasm ... -2.400 2.0e-03
lung cancer -2.400 1.6e-04
colon cancer -1.200 1.3e-02
breast carcinoma -1.200 1.8e-03
lung adenocarcinoma -2.806 2.5e-18
adult high grade glioma -2.400 5.3e-04
pilocytic astrocytoma -1.200 6.5e-03
inflammatory breast cancer 1.300 1.5e-02
lung carcinoma -1.500 1.0e-06
gastric carcinoma 1.200 3.0e-02
invasive ductal carcinoma -1.400 1.3e-02
ovarian cancer -1.700 1.2e-05

Gene RIF (4)

PMID Text
24349219 Results in this study identify the KIAA1462 locus as a candidate locus for late onset Alzheimer disease in APOE4 carriers.
21088011 KIAA1462 gene encodes a yet uncharacterized protein, on chromosome 10p11.23 with genome-wide significant association for CAD/MI
21088011 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYSVEDLLISHGYKLSRDPPASREDNPKGRQAARTGTRAGQGLQNGHEDGPAALAHRKTSAGKGHVSDSE      1 - 70
SRRSTPRGHGEPQSTSASRTSEAGFCNQPPSAWSSHPPTGNDQAYRRRGRQEARSQKPREHENLEARGMA     71 - 140
QAHSLPVHVREGPWEVGGRSEHVMKKPVWEEELRMSGPAKWQNVSLESWNQPRKLGRQMSDGDGERLFQD    141 - 210
LYPFIQGEHVLNSQNKGKSRSLPRVLSPESLSCTEIPIPLNERHSPKMPPYPPTCAPNLDSTRNSEKSGC    211 - 280
SAPFPRPKFGRPLKPPSYSSHQQSRGGADSSDSQDSQQMDAYVPRHELCLSDPGLEPPVYVPPPSYRSPP    281 - 350
QNIPNPYLEDTVPINVCGGHSQQQSPTEKAGASGQPPSGPPGTGNEYGVSPRLPQGLPAHPRPVTAYDGF    351 - 420
VQYIPFDDPRLRHFKLAQPQGFCEDIKLDDKSYNSSPVTAQEPAHGGMQPDGAIWNPQSLIPPSGDERGL    421 - 490
VLADSSPRWLWGQPPGDGENSGLPNQRDRCVARGQWPDVRGSQHGHTGRQVSSPYSQGESTCETQTKLKK    491 - 560
FQTGTRTKKSSKKKMNETIFCLVSIPVKSESHLPDRDMDNNDLKPSADQKNGSDKSPALQEQSLLSMSST    561 - 630
DLELQALTGSMGGRTEFQKQDLGEPEEDRQTNDLSFIHLTKHRELKHSGSWPGHRYRDQQTQTSFSEEPQ    631 - 700
SSQLLPGAKLGGPSRAALSPKCSDPAASEAQTHTAFPTGDHKQRPSARNLKGHRSLSPSSNSAFSRTSLS    701 - 770
VDQAPTPKAGRSQPCVDVHGLGAHPGPKREVVKGEPTGPCNSKQLFGQFLLKPVSRRPWDLISQLESFNK    771 - 840
ELQEEEESSSSSSSSSSSSEESEAEPQQENRAHCRQEDVGFRGNSPEMRVEPQPRMWVPESPVCRSGRGE    841 - 910
SKSESWSEELQPGHPRAWPPSPGRFRVEEGGGAPFCSADGSTSAEKRHLEVSNGMDELAGSPFPVTRMSS    911 - 980
RSSDAKPLPASYPAEPREPQESPKITSAFSSVKPSEAVPRKFDSGGERGAGLPLSLSNKNRGLSAPDLRS    981 - 1050
VGLTPGQEQGASELEGSLGEASTIEIPPGESLQARAARILGIEVAVESLLPGIRRAGQNQPAEPDASACT   1051 - 1120
PESPQEELLSRPAPADVPRVSTDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTDPVPE   1121 - 1190
PEPSPLESKFFEQKDVETKPPFRSTLFHFVERTPSVAGSEKRLRSPSKVIESLQEKLASPPRRADPDRLM   1191 - 1260
RMKEVSSVSRMRVLSFRNADSQEDAEELKATTRGQAGLPGGLVSPGSGDRAQRLGHSLSVSKDSISREEK   1261 - 1330
EHPAAQKEKSMDQDFWCPDSYDPSRVERV                                            1331 - 1359
//

Text Mined References (14)

PMID Year Title
24349219 2013 KIAA1462, a coronary artery disease associated gene, is a candidate gene for late onset Alzheimer disease in APOE carriers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21884682 2011 A coronary artery disease-associated gene product, JCAD/KIAA1462, is a novel component of endothelial cell-cell junctions.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21088011 2011 Genome-wide association study identifies a new locus for coronary artery disease on chromosome 10p11.23.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.