Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.03
PubTator Score 10.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
nephrosclerosis 1.344 0.001
malignant mesothelioma -8.400 0.000
astrocytic glioma -2.100 0.003
ependymoma -2.100 0.006
oligodendroglioma -1.300 0.022
psoriasis -1.800 0.000
glioblastoma -2.300 0.000
osteosarcoma -1.880 0.015
cystic fibrosis 1.885 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
group 4 medulloblastoma -2.100 0.001
medulloblastoma, large-cell -2.400 0.004
primitive neuroectodermal tumor -2.000 0.002
non-small cell lung cancer -1.933 0.000
intraductal papillary-mucinous adenoma (... -2.600 0.000
intraductal papillary-mucinous carcinoma... -2.600 0.000
intraductal papillary-mucinous neoplasm ... -2.400 0.002
lung cancer -2.400 0.000
colon cancer -1.200 0.013
breast carcinoma -1.200 0.002
lung adenocarcinoma -2.806 0.000
adult high grade glioma -2.400 0.001
pilocytic astrocytoma -1.200 0.006
inflammatory breast cancer 1.300 0.015
lung carcinoma -1.500 0.000
gastric carcinoma 1.200 0.030
invasive ductal carcinoma -1.400 0.013
ovarian cancer -1.700 0.000

Gene RIF (4)

PMID Text
24349219 Results in this study identify the KIAA1462 locus as a candidate locus for late onset Alzheimer disease in APOE4 carriers.
21088011 KIAA1462 gene encodes a yet uncharacterized protein, on chromosome 10p11.23 with genome-wide significant association for CAD/MI
21088011 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYSVEDLLISHGYKLSRDPPASREDNPKGRQAARTGTRAGQGLQNGHEDGPAALAHRKTSAGKGHVSDSE      1 - 70
SRRSTPRGHGEPQSTSASRTSEAGFCNQPPSAWSSHPPTGNDQAYRRRGRQEARSQKPREHENLEARGMA     71 - 140
QAHSLPVHVREGPWEVGGRSEHVMKKPVWEEELRMSGPAKWQNVSLESWNQPRKLGRQMSDGDGERLFQD    141 - 210
LYPFIQGEHVLNSQNKGKSRSLPRVLSPESLSCTEIPIPLNERHSPKMPPYPPTCAPNLDSTRNSEKSGC    211 - 280
SAPFPRPKFGRPLKPPSYSSHQQSRGGADSSDSQDSQQMDAYVPRHELCLSDPGLEPPVYVPPPSYRSPP    281 - 350
QNIPNPYLEDTVPINVCGGHSQQQSPTEKAGASGQPPSGPPGTGNEYGVSPRLPQGLPAHPRPVTAYDGF    351 - 420
VQYIPFDDPRLRHFKLAQPQGFCEDIKLDDKSYNSSPVTAQEPAHGGMQPDGAIWNPQSLIPPSGDERGL    421 - 490
VLADSSPRWLWGQPPGDGENSGLPNQRDRCVARGQWPDVRGSQHGHTGRQVSSPYSQGESTCETQTKLKK    491 - 560
FQTGTRTKKSSKKKMNETIFCLVSIPVKSESHLPDRDMDNNDLKPSADQKNGSDKSPALQEQSLLSMSST    561 - 630
DLELQALTGSMGGRTEFQKQDLGEPEEDRQTNDLSFIHLTKHRELKHSGSWPGHRYRDQQTQTSFSEEPQ    631 - 700
SSQLLPGAKLGGPSRAALSPKCSDPAASEAQTHTAFPTGDHKQRPSARNLKGHRSLSPSSNSAFSRTSLS    701 - 770
VDQAPTPKAGRSQPCVDVHGLGAHPGPKREVVKGEPTGPCNSKQLFGQFLLKPVSRRPWDLISQLESFNK    771 - 840
ELQEEEESSSSSSSSSSSSEESEAEPQQENRAHCRQEDVGFRGNSPEMRVEPQPRMWVPESPVCRSGRGE    841 - 910
SKSESWSEELQPGHPRAWPPSPGRFRVEEGGGAPFCSADGSTSAEKRHLEVSNGMDELAGSPFPVTRMSS    911 - 980
RSSDAKPLPASYPAEPREPQESPKITSAFSSVKPSEAVPRKFDSGGERGAGLPLSLSNKNRGLSAPDLRS    981 - 1050
VGLTPGQEQGASELEGSLGEASTIEIPPGESLQARAARILGIEVAVESLLPGIRRAGQNQPAEPDASACT   1051 - 1120
PESPQEELLSRPAPADVPRVSTDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTDPVPE   1121 - 1190
PEPSPLESKFFEQKDVETKPPFRSTLFHFVERTPSVAGSEKRLRSPSKVIESLQEKLASPPRRADPDRLM   1191 - 1260
RMKEVSSVSRMRVLSFRNADSQEDAEELKATTRGQAGLPGGLVSPGSGDRAQRLGHSLSVSKDSISREEK   1261 - 1330
EHPAAQKEKSMDQDFWCPDSYDPSRVERV                                            1331 - 1359
//

Text Mined References (14)

PMID Year Title
24349219 2013 KIAA1462, a coronary artery disease associated gene, is a candidate gene for late onset Alzheimer disease in APOE carriers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21884682 2011 A coronary artery disease-associated gene product, JCAD/KIAA1462, is a novel component of endothelial cell-cell junctions.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21088011 2011 Genome-wide association study identifies a new locus for coronary artery disease on chromosome 10p11.23.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...