Property Summary

NCBI Gene PubMed Count 30
PubMed Score 5.22
PubTator Score 4.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 1.700 9.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 3.3e-04
lung cancer 2.100 3.8e-03
malignant mesothelioma 2.900 1.3e-07
non-small cell lung cancer 1.122 5.8e-14
osteosarcoma -1.090 1.0e-02
spina bifida -1.026 4.3e-02

Protein-protein Interaction (7)

Gene RIF (6)

AA Sequence

MARAGPRLVLSEEAVRAKSGLGPHRDLAELQSLSIPGTYQEKITHLGHSLMSLTGLKSLDLSRNSLVSLE      1 - 70
GIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDYRLFVVHLLPKLQQLDDRPVR     71 - 140
ASERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCTEALAKQSLVMDADDEAVLNLIAECEWDLGR    141 - 210
PPGSTSFSQKGREADSRGSQESRHLLSPQLVQYQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPL    211 - 280
YGAEPEASRAPRPHTYFTPHPDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMPVGRFQTFSDQEG    281 - 350
LGCPERTHGSSVPKESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTDTREPSPGSHSALPGKKTALQA    351 - 420
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDSSAMVGEDVGSLALESKSLQSRLAE    421 - 490
QQQQHAREMSEVTAELHHTHKELDDLRQHLDKSLEENSRLKSLLLSMKKEVKSADTAATLNLQIAGLQTS    491 - 560
VKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKT    561 - 630
MALFPHSSASHGGCQAC                                                         631 - 647
//

Text Mined References (35)

PMID Year Title