Property Summary

NCBI Gene PubMed Count 35
Grant Count 3
Funding $218,233.16
PubMed Score 37.03
PubTator Score 38.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P1U0
Symbols TEX6
ZR14
HTEX6
Rpa12
hZR14
HTEX-6
TCTEX6
tctex-6

Gene

Gene RIF (26)

PMID Text
25110835 ZNRD1 regulatory SNPs may be susceptibility makers for risk of both chronic HBV infection and HCC.
24842830 This study provides novel evidence that ZNRD1 polymorphism may confer host resistance to HIV-1 acquisition.
23893241 A miR-508-5p/ZNRD1/ABCB1 regulatory loop has a critical role in MDR in gastric cancer.
23874430 Variants in ZNRD1 gene predict HIV-1/AIDS disease progression in a Han Chinese population in Taiwan.
22697009 Nominal associations were found between ZNRD1 rs1150740 and risk of AERD via codominant and dominant genetic inheritance (P=.03; odds ratio, 1.14 [1.14-10.16]).
21080911 The results of human miRNA array and real-time PCR showed that ZNRD1 could significantly up-regulate the expression of miR-214 and down-regulate the expression of miR-296.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20192730 siRNA-based functional analysis showed that ZNRD1 down-regulation by siRNA or shRNA impaired HIV-1 replication at the transcription level in both lymphoid and nonlymphoid cells.
20192730 Observational study of gene-disease association. (HuGE Navigator)
20192730 Knockdown of zinc ribbon domain containing 1 (ZNRD1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM      1 - 70
SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS                   71 - 126
//

Text Mined References (35)

PMID Year Title
25110835 2015 Expression quantitative trait loci in long non-coding RNA ZNRD1-AS1 influence both HBV infection and hepatocellular carcinoma development.
24842830 2014 Regulatory variation in HIV-1 dependency factor ZNRD1 associates with host resistance to HIV-1 acquisition.
24489884 2014 Genome-wide association study of proneness to anger.
23893241 2014 miR-508-5p regulates multidrug resistance of gastric cancer by targeting ABCB1 and ZNRD1.
23874430 2013 Variants in ZNRD1 gene predict HIV-1/AIDS disease progression in a Han Chinese population in Taiwan.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22697009 2012 A possible association between ZNRD1 and aspirin-induced airway bronchoconstriction in a Korean population.
21080911 2011 Role of ZNRD1 (zinc ribbon domain-containing 1) in angiogenesis of leukaemia cells.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20192730 2010 ZNRD1 (zinc ribbon domain-containing 1) is a host cellular factor that influences HIV-1 replication and disease progression.
More...