Property Summary

NCBI Gene PubMed Count 37
PubMed Score 38.02
PubTator Score 38.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q9P1U0
Symbols TEX6
ZR14
HTEX6
Rpa12
hZR14
HTEX-6
TCTEX6
tctex-6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (28)

AA Sequence

MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM      1 - 70
SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS                   71 - 126
//

Text Mined References (37)

PMID Year Title