Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q9P1J3
Symbols PRO1488
AS1DHRS4
C14orf67
DHRS4AS1
C14orf167

 Compartment GO Term (0)

AA Sequence

MSEQNICNQKDKSTLPFCQAHLCEETTNRLCVSNKAVYSLECKWAESENRVSEGRWGRGCFIGVG           1 - 65
//

Text Mined References (5)

PMID Year Title