Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9P1J3
Symbols PRO1488
AS1DHRS4
DHRS4AS1
C14orf167

Gene

 Compartment GO Term (0)

AA Sequence

MSEQNICNQKDKSTLPFCQAHLCEETTNRLCVSNKAVYSLECKWAESENRVSEGRWGRGCFIGVG           1 - 65
//

Text Mined References (5)

PMID Year Title
26864944 2016 Enhancer RNA-driven looping enhances the transcription of the long noncoding RNA DHRS4-AS1, a controller of the DHRS4 gene cluster.
22891334 2012 AS1DHRS4, a head-to-head natural antisense transcript, silences the DHRS4 gene cluster in cis and trans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.