Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.23467941109776E-8
lung cancer 4473 5.86031493860798E-5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.339 0.000
lung cancer 1.600 0.000

Synonym

Accession Q9P1G2
Symbols C8orf39
PRO1905

Gene

 Compartment GO Term (0)

AA Sequence

MAQDFSQHPQTGIIRRHRFYSPKPLSTTPRGQSFLLSRQAKVATWDPMLSPDFQPKSAFKLTWTAQPPCL      1 - 70
SVTPSQGQTFHPNSPEGELPPDLTENTCPSQA                                           71 - 102
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.