Property Summary

NCBI Gene PubMed Count 10
Grant Count 11
Funding $1,596,492.5
PubMed Score 3.41
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer 1.100 0.002
cutaneous lupus erythematosus 1.800 0.002
osteosarcoma -2.348 0.002
glioblastoma 1.200 0.026
Atopic dermatitis 1.200 0.029
tuberculosis 1.500 0.004
lung cancer -1.300 0.044
breast carcinoma 1.200 0.002
interstitial cystitis 2.600 0.002
pediatric high grade glioma 1.200 0.009
posterior fossa group A ependymoma 1.100 0.004
primary Sjogren syndrome 1.300 0.002
invasive ductal carcinoma 2.400 0.001
psoriasis 1.300 0.000
inflammatory breast cancer 1.800 0.033
lung carcinoma -1.400 0.000
ductal carcinoma in situ 1.800 0.009
ulcerative colitis 2.100 0.000
ovarian cancer 2.000 0.003
head and neck cancer and chronic obstruc... 1.800 0.006

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLET      1 - 70
LYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDA     71 - 140
QPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWD    141 - 210
LATVTPWDSCHHEAAPGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPL    211 - 280
VQDLP                                                                     281 - 285
//

Text Mined References (10)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12928397 2003 Functional requirements for interactions between CD84 and Src homology 2 domain-containing proteins and their contribution to human T cell activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313408 2001 Cloning, expression, and function of BLAME, a novel member of the CD2 family.