Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.51
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.100 6.4e-03
Atopic dermatitis 1.200 2.9e-02
breast carcinoma 1.200 1.5e-03
cutaneous lupus erythematosus 1.700 3.2e-03
ductal carcinoma in situ 1.800 8.6e-03
gastric cancer 1.100 1.6e-03
glioblastoma 1.100 3.6e-03
head and neck cancer and chronic obstruc... 1.800 6.1e-03
inflammatory breast cancer 1.800 3.3e-02
interstitial cystitis 1.700 3.9e-03
invasive ductal carcinoma 1.692 1.1e-04
lung cancer -1.300 4.4e-02
lung carcinoma -1.400 3.4e-09
osteosarcoma -2.348 2.2e-03
ovarian cancer 2.000 3.5e-03
posterior fossa group A ependymoma 1.100 3.9e-03
primary Sjogren syndrome 1.300 2.5e-03
psoriasis 1.300 4.8e-07
tuberculosis 1.500 3.8e-03
ulcerative colitis 2.100 7.0e-07

Gene RIF (1)

AA Sequence

MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLET      1 - 70
LYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDA     71 - 140
QPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWD    141 - 210
LATVTPWDSCHHEAAPGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPL    211 - 280
VQDLP                                                                     281 - 285
//

Text Mined References (10)

PMID Year Title