Property Summary

NCBI Gene PubMed Count 24
PubMed Score 39.17
PubTator Score 23.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.7e-05
psoriasis 6694 3.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Rett syndrome 18 4.678 2.3
Klatskin's tumor 3 3.29 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.305 2.7e-05
psoriasis 2.100 3.0e-05

Gene RIF (8)

AA Sequence

MEGDGSDPEPPDAGEDSKSENGENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYC      1 - 70
RECREKDPKLEIRYRHKKSRERDGNERDSSEPRDEGGGRKRPVPDPDLQRRAGSGTGVGAMLARGSASPH     71 - 140
KSSPQPLVATPSQHHQQQQQQIKRSARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQCQL    141 - 210
RARESYKYFPSSLSPVTPSESLPRPRRPLPTQQQPQPSQKLGRIREDEGAVASSTVKEPPEATATPEPLS    211 - 280
DEDLPLDPDLYQDFCAGAFDDHGLPWMSDTEESPFLDPALRKRAVKVKHVKRREKKSEKKKEERYKRHRQ    281 - 350
KQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPC    351 - 420
IAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDTDLQIFCVSCG    421 - 490
HPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPA    491 - 560
DEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRA    561 - 630
GLLALMLHQTIQHDPLTTDLRSSADR                                                631 - 656
//

Text Mined References (33)

PMID Year Title