Property Summary

NCBI Gene PubMed Count 24
Grant Count 60
R01 Count 37
Funding $5,417,832.09
PubMed Score 36.42
PubTator Score 23.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.100 0.000
osteosarcoma -1.305 0.000

Synonym

Accession Q9P0U4 B2RC03 Q8N2W4 Q96BC8 Q9P2V7
Symbols CFP1
CGBP
SPP1
PCCX1
PHF18
hCGBP
ZCGPC1
HsT2645
2410002I16Rik
5830420C16Rik

Gene

PDB

3QMB   3QMC   3QMD   3QMG   3QMH   3QMI  

Gene RIF (8)

PMID Text
23851690 NF-kappaB recruitment enhanced the occupancy of the CpG island within the 14-3-3gamma promoter by CFP1.14-3-3gamma induction in CSR is enabled by the CFP1-mediated H3K4me3 enrichment in the promoter, dependent on NF-kappaB and sustained by E2A.
21407193 The crescent-shaped CFP1 CXXC domain is wedged into the major groove of the CpG DNA, distorting the B-form DNA, and interacts extensively with the major groove of the DNA.
19454010 Three components (Setd1A, CXXC1, WDR5) of the Set1 histone methyltransferase complex are identified to interact with HIV-1 Tat in Jurkat cell
19433449 expression of either the amino half of Cfp1 (amino acids 1 to 367 [Cfp1(1-367)]) or the carboxyl half of Cfp1 (Cfp1(361-656)) is sufficient to correct all of the defects observed with embryonic stem cells that lack Cfp1
18680430 study shows endogenous DNMT1 & CFP1 interact in vivo; CFP1 interaction with Setd1A or Setd1B not required for its interaction with DNMT1; result indicates CFP1 intersects cytosine methylation machinery independently of its association with Setd1 complexes
18082152 CGBP interacts with MLL1, MLL2 as well as Set1 H3-Lysine 4 (H3K4) specific methyl-transferases and plays critical roles in regulations of MLL target genes.
17328666 CXXC finger protein 1 is required for normal proliferation and differentiation of the PLB-985 myeloid cell line.
16253997 CXXC finger protein 1 is a component of the mammalian Set1 histone H3-Lys4 methyltransferase complex

AA Sequence

MEGDGSDPEPPDAGEDSKSENGENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYC      1 - 70
RECREKDPKLEIRYRHKKSRERDGNERDSSEPRDEGGGRKRPVPDPDLQRRAGSGTGVGAMLARGSASPH     71 - 140
KSSPQPLVATPSQHHQQQQQQIKRSARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQCQL    141 - 210
RARESYKYFPSSLSPVTPSESLPRPRRPLPTQQQPQPSQKLGRIREDEGAVASSTVKEPPEATATPEPLS    211 - 280
DEDLPLDPDLYQDFCAGAFDDHGLPWMSDTEESPFLDPALRKRAVKVKHVKRREKKSEKKKEERYKRHRQ    281 - 350
KQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPC    351 - 420
IAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDTDLQIFCVSCG    421 - 490
HPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPA    491 - 560
DEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRA    561 - 630
GLLALMLHQTIQHDPLTTDLRSSADR                                                631 - 656
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23851690 2013 Induction of activation-induced cytidine deaminase-targeting adaptor 14-3-3? is mediated by NF-?B-dependent recruitment of CFP1 to the 5'-CpG-3'-rich 14-3-3? promoter and is sustained by E2A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
21407193 2011 The structural basis for selective binding of non-methylated CpG islands by the CFP1 CXXC domain.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...