Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.55
PubTator Score 5.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.100 3.4e-02
intraductal papillary-mucinous carcinoma... 1.500 1.5e-03
invasive ductal carcinoma 1.200 3.7e-03
non-small cell lung cancer 1.213 3.7e-14
ovarian cancer 1.100 1.2e-03
primary pancreatic ductal adenocarcinoma 1.020 8.0e-03
tuberculosis -1.100 3.0e-06

Gene RIF (5)

AA Sequence

MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPH      1 - 70
HESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLPRSPSFPLEPDDEVFLAIAKA     71 - 140
MEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLWFKRC    141 - 210
FAGCLPESSLQRVWDKVVSGSCKILVFVAVEILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAID    211 - 280
LWHKHCGTPVHSS                                                             281 - 293
//

Text Mined References (22)

PMID Year Title