Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5.43
PubTator Score 8.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.9e-04
group 3 medulloblastoma 2.100 7.5e-07
lung carcinoma 1.300 2.3e-24
medulloblastoma, large-cell 1.800 4.5e-06
osteosarcoma 1.043 2.2e-02
primitive neuroectodermal tumor 1.500 3.1e-04

Gene RIF (7)

AA Sequence

MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARD      1 - 70
NKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKAT     71 - 140
SGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSM    141 - 210
RVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQ    211 - 280
WGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVY    281 - 350
FLLFDSESIGIYVQEMAKLDAK                                                    351 - 372
//

Text Mined References (26)

PMID Year Title