Property Summary

NCBI Gene PubMed Count 23
Grant Count 11
R01 Count 11
Funding $1,078,471.42
PubMed Score 5.36
PubTator Score 8.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.043 0.022
group 4 medulloblastoma 2.400 0.000
atypical teratoid/rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.500 0.000
lung carcinoma 1.300 0.000

Gene RIF (7)

PMID Text
20080650 Observational study of gene-disease association. (HuGE Navigator)
19648962 expression of histone macroH2A1.1 and macroH2A2 predicts lung cancer recurrence.
16385451 Observational study of gene-disease association. (HuGE Navigator)
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARD      1 - 70
NKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKAT     71 - 140
SGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSM    141 - 210
RVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQ    211 - 280
WGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVY    281 - 350
FLLFDSESIGIYVQEMAKLDAK                                                    351 - 372
//

Text Mined References (25)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
24071584 2014 macroH2A1 histone variant represses rDNA transcription.
23595991 2013 Macro histone variants are critical for the differentiation of human pluripotent cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19734898 2009 The histone variant macroH2A is an epigenetic regulator of key developmental genes.
19648962 2009 Histone macroH2A isoforms predict the risk of lung cancer recurrence.
More...