Property Summary

NCBI Gene PubMed Count 31
Grant Count 75
R01 Count 34
Funding $18,302,113.2
PubMed Score 86.05
PubTator Score 43.42

Knowledge Summary

Patent (33,865)

Expression

Synonym

Accession Q9P0L9 O75972 Q5W039 Q9UP35 Q9UPA2
Symbols PCL
PKDL
PKD2L
TRPP3

Gene

PDB

3TE3   4GIF  

Gene RIF (9)

PMID Text
25820328 our study identified C1 as the first PKD2L1 domain essential for both PKD2L1 trimerization and channel function, and suggest that PKD2L1 and PKD2L1/PKD1L3 channels share the PKD2L1 trimerization process.
22794107 This study demonistrated that human PKD2L play the role of food preference behavior.
22193359 Trimerization may be important for both homo- and possibly heteromeric assemblies of PKD2L1.
22174419 Pkd2L1 is a novel target channel whose function is regulated by the versatile scaffolding protein RACK1.
20408813 Despite the moderate sequence identity between C-terminal regulatory domains (CRDs) of PKD2 and PKD2L1, they both form trimers, implying that trimeric organization of CRDs may be true of all polycystin channels.
20406802 the PKD2L1-PKD1L3 complex is involved in acid sensing in vivo
17944866 Taken together, alpha-actinin not only attaches TRPP3 to the cytoskeleton but also up-regulates TRPP3 channel function.
16385451 Observational study of gene-disease association. (HuGE Navigator)
11959145 The calcium-binding EF-hand in polycystin-L is not a domain for channel activation and ensuing inactivation.

AA Sequence

MNAVGSPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQETAYRTQVSSCC      1 - 70
LHICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHT     71 - 140
PSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSC    141 - 210
VVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQG    211 - 280
SAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDF    281 - 350
FIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ    351 - 420
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFA    421 - 490
YAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAII    491 - 560
NDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGH    561 - 630
AEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGG    631 - 700
WVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPW    701 - 770
GVQGGQESEVPYKREEEALEERRLSRGEIPTLQRS                                       771 - 805
//

Text Mined References (36)

PMID Year Title
25820328 2015 A novel PKD2L1 C-terminal domain critical for trimerization and channel function.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24336289 2013 Direct recording and molecular identification of the calcium channel of primary cilia.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23212381 2012 Molecular mechanism of the assembly of an acid-sensing receptor ion channel complex.
22794107 2012 Behavioral analysis of Drosophila transformants expressing human taste receptor genes in the gustatory receptor neurons.
22420714 2012 The response of PKD1L3/PKD2L1 to acid stimuli is inhibited by capsaicin and its pungent analogs.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
More...