Property Summary

Ligand Count 6
NCBI Gene PubMed Count 33
PubMed Score 96.83
PubTator Score 43.42

Knowledge Summary

Patent (33,865)


Gene RIF (10)

AA Sequence

GVQGGQESEVPYKREEEALEERRLSRGEIPTLQRS                                       771 - 805

Text Mined References (38)

PMID Year Title