Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.04
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Newcastle disease 13 4.434 2.2
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.100 0.000

Synonym

Accession Q9P000 E9PAN2 Q96FI2 Q9H0R0
Symbols HSPC166

Gene

PDB

4NKN   4OE9  

AA Sequence

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRL      1 - 70
VAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSIS     71 - 140
RMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK                141 - 198
//

Text Mined References (15)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
23637203 2013 Functional interaction of COMMD3 and COMMD9 with the epithelial sodium channel.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21269460 2011 Initial characterization of the human central proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...