Property Summary

NCBI Gene PubMed Count 24
Grant Count 2
R01 Count 2
Funding $149,689
PubMed Score 32.66
PubTator Score 18.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
oligodendroglioma -1.300 0.041
psoriasis -2.400 0.000
osteosarcoma -2.649 0.001
group 4 medulloblastoma -2.600 0.000
medulloblastoma, large-cell -1.400 0.000
autosomal dominant Emery-Dreifuss muscul... 1.247 0.009
fascioscapulohumeral muscular dystrophy 1.208 0.000
non-small cell lung cancer -1.272 0.000
lung cancer -4.000 0.000
lung adenocarcinoma -1.700 0.000
lung carcinoma -2.300 0.000
breast carcinoma -1.300 0.000
Breast cancer -2.100 0.000
gastric carcinoma 1.200 0.009
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.500 0.001
ovarian cancer -3.100 0.000
pituitary cancer -1.400 0.002
dermatomyositis 1.700 0.002

Synonym

Accession Q9NZV1 Q2M2G4 Q59GH0 Q7LCQ5 Q9H318 CRIM-1
Symbols S52
CRIM-1

Gene

 Grant Application (2)

Gene RIF (12)

PMID Text
26653968 These observations provide evidence for the first time that CRIM1 plays a role in cancer cells by enhancing the migration and adhesion and increasing the expression of N-CAD and E-CAD.
25956066 Knock down of CRIM1 had no effect on VEGF-induced proliferation or migration of umbilical vein endothelial cells (HUVECs), indicating that basal CRIM1 is not involved in the proliferation or migration of endothelial cells.
25561690 CRIM1 is the causative gene for Colobomatous macrophthalmia with microcornea syndrome and is important for eye development.
25088037 Data suggest that CRIM1 plays role in cancer progression/metastasis, epithelial-mesenchymal transition, and neoplastic angiogenesis. [REVIEW]
25086356 CRIM1 is an early response gene in the presence of both angiogenic stimulation (VEGF) and environmental (extracellular matrix) factors, and Erk and FAK might be involved in the upregulation of CRIM1 mRNA expression in vascular endothelial cells.
24617547 BMPs inhibitor CRIM1 is increased and correlates with higher levels of serum PIPIII showing an imbalance in favor of pro-fibrotic mechanisms in CHF.
21036735 Study demonstrated that CRIM1 is expressed at high levels in resistant leukemia cells, indicating that CRIM1 may play a role in drug-resistance.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19260139 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of cysteine rich transmembrane BMP regulator 1 (CRIM1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQR      1 - 70
NESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKC     71 - 140
ECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLPSRC    141 - 210
VCNPAGCLRKVCQPGNLNILVSKASGKPGECCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLT    211 - 280
ADGCCTLPTRCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFR    281 - 350
MDNCRFCRCQGGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDD    351 - 420
CTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGKDCINGFKRDH    421 - 490
NGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCRPIICDKYCPLGLLKNKHGCD    491 - 560
ICRCKKCPELSCSKICPLGFQQDSHGCLICKCREASASAGPPILSGTCLTVDGHHHKNEESWHDGCRECY    561 - 630
CLNGREMCALITCPVPACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQ    631 - 700
CTCHSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFLAAESWKPD    701 - 770
VCTSCICIDSVISCFSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHC    771 - 840
YCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVPLWPTPSENDI    841 - 910
VHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVVPIIICLSIIIAFLFINQKKQWIPLLCWYRTPTKPS    911 - 980
SLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYSMQKQNHLQADNFYQTV                  981 - 1036
//

Text Mined References (26)

PMID Year Title
26653968 2015 CRIM1, a newfound cancer-related player, regulates the adhesion and migration of lung cancer cells.
25956066 2015 Inhibition of the proliferation and acceleration of migration of vascular endothelial cells by increased cysteine-rich motor neuron 1.
25561690 2015 CRIM1 haploinsufficiency causes defects in eye development in human and mouse.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25088037 2014 CRIM1, the antagonist of BMPs, is a potential risk factor of cancer.
25086356 2014 Induction of cysteine-rich motor neuron 1 mRNA expression in vascular endothelial cells.
24617547 2014 Fibrosis markers and CRIM1 increase in chronic heart failure of increasing severity.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
More...