Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.29
PubTator Score 18.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.247 9.1e-03
Breast cancer -2.100 4.0e-10
breast carcinoma -1.200 2.7e-22
dermatomyositis 1.400 3.9e-02
ductal carcinoma in situ -1.500 3.6e-04
fascioscapulohumeral muscular dystrophy 1.208 3.9e-04
gastric carcinoma 1.200 9.4e-03
group 4 medulloblastoma -2.600 4.9e-06
invasive ductal carcinoma -2.500 5.3e-04
lung adenocarcinoma -1.200 9.8e-17
lung cancer -3.100 3.6e-06
lung carcinoma -2.300 3.0e-17
medulloblastoma, large-cell -1.200 1.3e-03
non-small cell lung cancer -1.272 3.5e-15
oligodendroglioma -1.300 4.1e-02
osteosarcoma -2.649 7.4e-04
ovarian cancer -3.100 3.2e-10
pituitary cancer -1.400 2.5e-03
psoriasis -2.400 4.5e-05

 CSPA Cell Line (1)

Gene RIF (13)

AA Sequence

MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQR      1 - 70
NESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKC     71 - 140
ECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLPSRC    141 - 210
VCNPAGCLRKVCQPGNLNILVSKASGKPGECCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLT    211 - 280
ADGCCTLPTRCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFR    281 - 350
MDNCRFCRCQGGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDD    351 - 420
CTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGKDCINGFKRDH    421 - 490
NGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCRPIICDKYCPLGLLKNKHGCD    491 - 560
ICRCKKCPELSCSKICPLGFQQDSHGCLICKCREASASAGPPILSGTCLTVDGHHHKNEESWHDGCRECY    561 - 630
CLNGREMCALITCPVPACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQ    631 - 700
CTCHSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFLAAESWKPD    701 - 770
VCTSCICIDSVISCFSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHC    771 - 840
YCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVPLWPTPSENDI    841 - 910
VHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVVPIIICLSIIIAFLFINQKKQWIPLLCWYRTPTKPS    911 - 980
SLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYSMQKQNHLQADNFYQTV                  981 - 1036
//

Text Mined References (27)

PMID Year Title