Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.36
PubTator Score 19.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
periodontitis 293 7.0e-16
psoriasis 6694 3.2e-05
non-small cell lung cancer 2890 1.3e-03
esophageal adenocarcinoma 737 2.2e-02
nasopharyngeal carcinoma 1058 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -1.500 2.2e-02
nasopharyngeal carcinoma -1.400 2.7e-02
non-small cell lung cancer 1.116 1.3e-03
periodontitis -1.300 7.0e-16
psoriasis 2.700 3.2e-05

Gene RIF (8)

AA Sequence

MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFL      1 - 70
TAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFA     71 - 140
RMLAQE                                                                    141 - 146
//

Text Mined References (16)

PMID Year Title