Property Summary

NCBI Gene PubMed Count 13
PubMed Score 20.01
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -1.500 0.022
psoriasis 2.700 0.000
periodontitis -1.300 0.000
non-small cell lung cancer 1.116 0.001
nasopharyngeal carcinoma -1.400 0.027

Synonym

Accession Q9NZT1 Q5SQI3 Q8IXU8
Symbols CLSP

Gene

PDB

2B1U  

Gene RIF (7)

PMID Text
26545810 CALML5 interacts with SFN in suprabasal epidermis, cocontrols 13% of late differentiation genes, and modulates interaction of SFN to some of its binding partners.
24279918 CLSP is increased in the upper epidermis in exacerbated atopic dermatitis as compared to non-exacerbated atopic dermatitis and normal skin, revealing a role in re-establishing the epidermal barrier
24146193 Ubiquitination of CALML5 in the nucleus is involved in the carcinogenesis of breast cancer in premenopausal women.
23519124 CLSP is a physiological heterotrimeric humanin receptor agonist.
16765896 The structure and dynamics of human calmodulin-like skin protein (CLSP) have been characterized by NMR spectroscopy.
16689864 abnormal elevated levels of CLSP, characteristic of psoriatic epidermis, were probably not due to an overexpression of the protein, but most likely the result of its non-degradation
11969404 An investigation of the cation-binding properties of CLSP and the ensuing conformational changes finds that, with its high- and low-affinity Ca+2+-binding sites and a pronounced effect of Mg2+, CLSP is more similar to troponin C than to calmodulin.

AA Sequence

MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFL      1 - 70
TAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFA     71 - 140
RMLAQE                                                                    141 - 146
//

Text Mined References (16)

PMID Year Title
26545810 2015 CALML5 is a ZNF750- and TINCR-induced protein that binds stratifin to regulate epidermal differentiation.
24279918 2013 Calmodulin-like skin protein level increases in the differentiated epidermal layers in atopic dermatitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146193 2013 Specific expression of k63-linked ubiquitination of calmodulin-like protein 5 in breast cancer of premenopausal patients.
23519124 2013 Secreted calmodulin-like skin protein inhibits neuronal death in cell-based Alzheimer's disease models via the heterotrimeric Humanin receptor.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17488105 2007 Detection and validation of non-synonymous coding SNPs from orthogonal analysis of shotgun proteomics data.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16765896 2006 A structural and dynamic characterization of the EF-hand protein CLSP.
16689864 2006 Influence of calcium on the proteolytic degradation of the calmodulin-like skin protein (calmodulin-like protein 5) in psoriatic epidermis.
More...