Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $275,658.83
PubMed Score 12.20
PubTator Score 14.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 0.001
osteosarcoma -2.678 0.001
tuberculosis 1.300 0.000
non-small cell lung cancer -1.761 0.000
X-linked agammaglobulinemia -1.262 0.047
intraductal papillary-mucinous neoplasm ... -1.200 0.004
lung cancer -1.400 0.001
lung adenocarcinoma -1.700 0.000
lung carcinoma -1.900 0.000
type I diabetes mellitus -1.001 0.018

Gene RIF (6)

PMID Text
23929856 our data report a previously unrecognized regulatory circuit enabling autonomous control of human NK cell responses via the NKp80-AICL axis.
23609447 Two non-consensus amino acids of NKp80, in particular arginine 6, critically impair both hemi-immunoreceptor tyrosine-based activation motif phosphorylation and Syk recruitment.
22715368 IL-15+IL-12 has an immunomodulatory effect on NK cell subsets from HIV-infected individuals viz down-regulation of iNKRs, elevation of activatory receptors NKp46 and NKG2D, and induction of coreceptor NKp80.
21149606 Activating receptor NKp80 induces cytotoxicity by using an atypical hemi-ITAM amino acid seqeuence and the Syk-kinase pathway.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18922855 NKp80 is expressed on a highly responsive subset of effector memory CD8 T cells with an inflammatory NK-like phenotype and promotes T-cell responses toward AICL-expressing cells.

AA Sequence

MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKC      1 - 70
QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCCYWFSNEMKSWSDSY     71 - 140
VYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCA    141 - 210
AIKESKIFSETCSSVFKWICQY                                                    211 - 232
//

Text Mined References (12)

PMID Year Title
23929856 2013 Genetically coupled receptor-ligand pair NKp80-AICL enables autonomous control of human NK cell responses.
23609447 2013 Attenuated natural killer (NK) cell activation through C-type lectin-like receptor NKp80 is due to an anomalous hemi-immunoreceptor tyrosine-based activation motif (HemITAM) with impaired Syk kinase recruitment capacity.
22715368 2012 Effect of recombinant cytokines on the expression of natural killer cell receptors from patients with TB or/and HIV infection.
21149606 2011 Cutting edge: NKp80 uses an atypical hemi-ITAM to trigger NK cytotoxicity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18922855 2009 NKp80 defines and stimulates a reactive subset of CD8 T cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11513955 2001 Molecular characterization of two novel alternative spliced variants of the KLRF1 gene and subcellular distribution of KLRF1 isoforms.
More...