Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.20
PubTator Score 14.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.47088136178474E-16
lung adenocarcinoma 2714 1.10746697233153E-14
lung carcinoma 2844 8.78897499602725E-10
tuberculosis 1563 2.1345165308524E-4
cutaneous lupus erythematosus 1056 8.70754807355452E-4
osteosarcoma 7933 8.80156053885661E-4
lung cancer 4473 9.30827065603819E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00438411363011792
type I diabetes mellitus 22 0.0184065149165439
X-linked agammaglobulinemia 7 0.0465234341083511

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 0.001
osteosarcoma -2.678 0.001
tuberculosis 1.300 0.000
non-small cell lung cancer -1.761 0.000
X-linked agammaglobulinemia -1.262 0.047
intraductal papillary-mucinous neoplasm ... -1.200 0.004
lung cancer -1.400 0.001
lung adenocarcinoma -1.700 0.000
lung carcinoma -1.900 0.000
type I diabetes mellitus -1.001 0.018

Synonym

Accession Q9NZS2 Q4KMT5 Q96PR2 Q96PR3 Q9NZS1 Lectin-like receptor F1
Symbols NKp80
CLEC5C

Gene

  Ortholog (4)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (6)

PMID Text
23929856 our data report a previously unrecognized regulatory circuit enabling autonomous control of human NK cell responses via the NKp80-AICL axis.
23609447 Two non-consensus amino acids of NKp80, in particular arginine 6, critically impair both hemi-immunoreceptor tyrosine-based activation motif phosphorylation and Syk recruitment.
22715368 IL-15+IL-12 has an immunomodulatory effect on NK cell subsets from HIV-infected individuals viz down-regulation of iNKRs, elevation of activatory receptors NKp46 and NKG2D, and induction of coreceptor NKp80.
21149606 Activating receptor NKp80 induces cytotoxicity by using an atypical hemi-ITAM amino acid seqeuence and the Syk-kinase pathway.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18922855 NKp80 is expressed on a highly responsive subset of effector memory CD8 T cells with an inflammatory NK-like phenotype and promotes T-cell responses toward AICL-expressing cells.

AA Sequence

MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKC      1 - 70
QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCCYWFSNEMKSWSDSY     71 - 140
VYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCA    141 - 210
AIKESKIFSETCSSVFKWICQY                                                    211 - 232
//

Text Mined References (12)

PMID Year Title
23929856 2013 Genetically coupled receptor-ligand pair NKp80-AICL enables autonomous control of human NK cell responses.
23609447 2013 Attenuated natural killer (NK) cell activation through C-type lectin-like receptor NKp80 is due to an anomalous hemi-immunoreceptor tyrosine-based activation motif (HemITAM) with impaired Syk kinase recruitment capacity.
22715368 2012 Effect of recombinant cytokines on the expression of natural killer cell receptors from patients with TB or/and HIV infection.
21149606 2011 Cutting edge: NKp80 uses an atypical hemi-ITAM to trigger NK cytotoxicity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18922855 2009 NKp80 defines and stimulates a reactive subset of CD8 T cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11513955 2001 Molecular characterization of two novel alternative spliced variants of the KLRF1 gene and subcellular distribution of KLRF1 isoforms.
More...