Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.78
PubTator Score 14.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 8.7e-04
intraductal papillary-mucinous neoplasm ... -1.200 4.4e-03
lung adenocarcinoma -1.500 8.7e-12
lung cancer -1.400 9.3e-04
lung carcinoma -1.900 8.8e-10
non-small cell lung cancer -1.761 1.5e-16
osteosarcoma -2.678 8.8e-04
tuberculosis 1.300 2.1e-04
type I diabetes mellitus -1.001 1.8e-02
X-linked agammaglobulinemia -1.262 4.7e-02

Gene RIF (8)

AA Sequence

MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKC      1 - 70
QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCCYWFSNEMKSWSDSY     71 - 140
VYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCA    141 - 210
AIKESKIFSETCSSVFKWICQY                                                    211 - 232
//

Text Mined References (14)

PMID Year Title