Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.06
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 4.0e-05
atypical teratoid / rhabdoid tumor -1.300 5.8e-04
Breast cancer 2.300 4.6e-02
cystic fibrosis 1.485 4.5e-06
ductal carcinoma in situ -1.200 2.1e-03
ependymoma -1.100 4.0e-02
gastric cancer 1.100 2.5e-03
glioblastoma -1.500 1.8e-06
group 3 medulloblastoma -1.200 1.0e-02
invasive ductal carcinoma -1.500 2.1e-03
lung carcinoma 1.600 5.2e-27
medulloblastoma, large-cell -1.200 1.6e-03
ovarian cancer -2.800 5.2e-11
primitive neuroectodermal tumor -1.400 1.2e-03
subependymal giant cell astrocytoma -1.268 2.3e-02

Protein-protein Interaction (4)

Gene RIF (1)

AA Sequence

MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLL      1 - 70
MYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGV     71 - 140
HNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNI    141 - 210
PIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKE    211 - 280
NDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADR    281 - 350
R//

Text Mined References (8)

PMID Year Title