Property Summary

NCBI Gene PubMed Count 8
PubMed Score 69.99
PubTator Score 8.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

AA Sequence

MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQ      1 - 70
YLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTL     71 - 140
MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPI    141 - 210
PMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENA    211 - 280
TLTELRVDNQRQWPGDAVEMEMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR         281 - 345
//

Text Mined References (9)

PMID Year Title