Property Summary

NCBI Gene PubMed Count 7
Grant Count 28
R01 Count 16
Funding $4,098,505.51
PubMed Score 67.67
PubTator Score 8.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

AA Sequence

MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQ      1 - 70
YLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTL     71 - 140
MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPI    141 - 210
PMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENA    211 - 280
TLTELRVDNQRQWPGDAVEMEMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR         281 - 345
//

Text Mined References (9)

PMID Year Title
25250574 2014 Leiomodin-3 dysfunction results in thin filament disorganization and nemaline myopathy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11716785 2001 Genomic organization of Tropomodulins 2 and 4 and unusual intergenic and intraexonic splicing of YL-1 and Tropomodulin 4.
10662549 2000 Sequencing, expression analysis, and mapping of three unique human tropomodulin genes and their mouse orthologs.
10497209 1999 Identification of a novel tropomodulin isoform, skeletal tropomodulin, that caps actin filament pointed ends in fast skeletal muscle.