Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.61
PubTator Score 3.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.320 1.9e-02
adult high grade glioma 1.500 6.6e-03
aldosterone-producing adenoma -1.978 7.9e-03
Astrocytoma, Pilocytic 2.300 2.2e-08
atypical teratoid/rhabdoid tumor 1.600 6.0e-04
cystic fibrosis 1.491 5.5e-05
ependymoma 2.000 1.4e-06
glioblastoma 1.200 1.8e-02
group 4 medulloblastoma -1.300 9.1e-03
invasive ductal carcinoma -1.200 1.0e-04
lung cancer -2.100 5.2e-04
lung carcinoma -1.100 2.7e-22
malignant mesothelioma -2.200 3.6e-08
medulloblastoma, large-cell -1.800 3.4e-04
osteosarcoma -3.054 4.9e-04
ovarian cancer -2.900 3.0e-11
pancreatic ductal adenocarcinoma liver m... -1.473 5.4e-03
pituitary cancer -2.100 5.8e-06
Rheumatoid arthritis 1.800 3.2e-03
tuberculosis 2.100 8.3e-07

Gene RIF (8)

AA Sequence

MPGPRVWGKYLWRSPHSKGCPGAMWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEPYGKGQESSTD      1 - 70
IKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISFVGSDPSQFCGQQGSPLGRPPGQREFVSSGRSLRLTFR     71 - 140
TQPSSENKTAHLHKGFLALYQTVAVNYSQPISEASRGSEAINAPGDNPAKVQNHCQEPYYQAAAAGALTC    141 - 210
ATPGTWKDRQDGEEVLQCMPVCGRPVTPIAQNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILT    211 - 280
AAHTIYPKDSVSLRKNQSVNVFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIP    281 - 350
LGPNVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMF    351 - 420
CVGDETQRHSVCQGDSGSVYVVWDNHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIKGVMNGKN       421 - 487
//

Text Mined References (20)

PMID Year Title