Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.48
PubTator Score 3.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.71596779625294E-22
glioblastoma multiforme 347 4.13274122627947E-14
ovarian cancer 8492 2.98688110826639E-11
posterior fossa group A ependymoma 1511 2.9507436423355E-10
pilocytic astrocytoma 3086 2.95344140777107E-8
malignant mesothelioma 3163 3.60457425467969E-8
tuberculosis 1563 8.27314009551737E-7
pituitary cancer 1972 5.8080507452096E-6
cystic fibrosis 1670 5.53932465268266E-5
invasive ductal carcinoma 2950 1.04995397592415E-4
lung cancer 4473 1.80979796678616E-4
medulloblastoma, large-cell 6234 3.44655001436854E-4
osteosarcoma 7933 4.88258436869524E-4
atypical teratoid/rhabdoid tumor 1095 5.99855775178906E-4
Rheumatoid Arthritis 1171 0.00322939023081678
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00544052404487146
adult high grade glioma 2148 0.00661700679924479
aldosterone-producing adenoma 664 0.00785038569197258
group 4 medulloblastoma 1875 0.00908772222998588
adrenocortical carcinoma 1427 0.0192862895081897
Disease Target Count Z-score Confidence
CLL/SLL 2 3.726 1.9

Expression

  Differential Expression (20)

Synonym

Accession Q9NZP8 Q53GX9 C1r-LP
Symbols C1RL1
C1RLP
CLSPa
C1r-LP

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid

Gene RIF (8)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of complement component 1, r subcomponent-like (C1RL) in primary human brain microvascular endothelial cells
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
15385675 coexpression of the proform of Hp (proHp) and C1r-LP effected cleavage of proHp in the endoplasmic reticulum
15358180 CLSPa itself possesses little protease activity, but it plays an inhibitory role in other active protease catalytic processes

AA Sequence

MPGPRVWGKYLWRSPHSKGCPGAMWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEPYGKGQESSTD      1 - 70
IKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISFVGSDPSQFCGQQGSPLGRPPGQREFVSSGRSLRLTFR     71 - 140
TQPSSENKTAHLHKGFLALYQTVAVNYSQPISEASRGSEAINAPGDNPAKVQNHCQEPYYQAAAAGALTC    141 - 210
ATPGTWKDRQDGEEVLQCMPVCGRPVTPIAQNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILT    211 - 280
AAHTIYPKDSVSLRKNQSVNVFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIP    281 - 350
LGPNVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMF    351 - 420
CVGDETQRHSVCQGDSGSVYVVWDNHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIKGVMNGKN       421 - 487
//

Text Mined References (20)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...