Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.07
PubTator Score 2.99

Knowledge Summary

Patent (647)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.69009284090607E-8
osteosarcoma 7933 3.51970457365476E-7
Disease Target Count Z-score Confidence
Polycystic kidney disease 54 4.706 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.458 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q9NZM6 A6NK98 B4DXD2 E9PC91 E9PDG4 Q86YB4 Q9UNJ0
Symbols TRPP5

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSV      1 - 70
PGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNT     71 - 140
CKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSE    141 - 210
TKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDY    211 - 280
FIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLK    281 - 350
STEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFA    351 - 420
YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAII    421 - 490
NDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDENEIQ    491 - 560
NAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL          561 - 624
//

Text Mined References (8)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11959145 2002 The calcium-binding EF-hand in polycystin-L is not a domain for channel activation and ensuing inactivation.
11698076 2001 Polycystin channels and kidney disease.
10756092 2000 Identification and characterization of a novel polycystin family member, polycystin-L2, in mouse and human: sequence, expression, alternative splicing, and chromosomal localization.
10602361 1999 Genes homologous to the autosomal dominant polycystic kidney disease genes (PKD1 and PKD2).