Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.79
PubTator Score 2.99

Knowledge Summary

Patent (647)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.7e-08
osteosarcoma 7950 3.5e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.458 3.5e-07
ovarian cancer -1.800 3.7e-08

AA Sequence

MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSV      1 - 70
PGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNT     71 - 140
CKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSE    141 - 210
TKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDY    211 - 280
FIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLK    281 - 350
STEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFA    351 - 420
YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAII    421 - 490
NDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDENEIQ    491 - 560
NAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL          561 - 624
//

Text Mined References (8)

PMID Year Title