Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.60
PubTator Score 9.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (9)

PMID Text
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
22318382 IL36B expression is induced in keratinocytes by Toll-like receptor ligands suggesting a function in barrier immune defense.
21965679 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity
21242515 IL-1F8 functions as an inducer of antimicrobial peptide and matrix metalloproteinase expression by keratinocytes; IL-1F8 is overexpressed in transgenic psoriatic model mouse skin.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
18484691 Observational study of gene-disease association. (HuGE Navigator)
16646978 Joint and serum IL-1F8 protein levels did not correlate with inflammation, but they were high in samples from patients with rheumatoid arthritis
14734551 IL-1F6 and IL-1F8, in addition to IL-1F9, activate the pathway leading to NF-kappaB in an IL-1Rrp2-dependent manner in Jurkat cells

AA Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKD      1 - 70
LCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQ     71 - 140
HHHLRKKDKDFSSMRTNIGMPGRM                                                  141 - 164
//

Text Mined References (26)

PMID Year Title
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
22318382 2012 The double-stranded RNA analogue polyinosinic-polycytidylic acid induces keratinocyte pyroptosis and release of IL-36?.
21965679 2011 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36?, IL-36?, and IL-36?) or antagonist (IL-36Ra) activity.
21881584 2011 Inter-regulation of Th17 cytokines and the IL-36 cytokines in vitro and in vivo: implications in psoriasis pathogenesis.
21242515 2011 IL-1F5, -F6, -F8, and -F9: a novel IL-1 family signaling system that is active in psoriasis and promotes keratinocyte antimicrobial peptide expression.
20300079 2010 The effect of the interleukin-1 cytokine family members IL-1F6 and IL-1F8 on adipocyte differentiation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20141484 2010 The interleukin-1 family gene polymorphisms in Korean patients with rheumatoid arthritis.
18484691 2008 Interleukin 1 polymorphisms in patients with ankylosing spondylitis in Korea.
16646978 2006 The new IL-1 family member IL-1F8 stimulates production of inflammatory mediators by synovial fibroblasts and articular chondrocytes.
More...