Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.94
PubTator Score 9.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.5e-27
Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5

Gene RIF (9)

AA Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKD      1 - 70
LCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQ     71 - 140
HHHLRKKDKDFSSMRTNIGMPGRM                                                  141 - 164
//

Text Mined References (26)

PMID Year Title