Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.94
PubTator Score 5.70

Knowledge Summary

Patent (4,651)

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
oligodendroglioma 1.300 0.012
esophageal adenocarcinoma 1.800 0.024
psoriasis -1.100 0.000
osteosarcoma -1.322 0.006
group 4 medulloblastoma -2.200 0.000
glioblastoma -1.100 0.042
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -3.200 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.025
lung cancer -1.100 0.004
breast carcinoma -1.400 0.000
subependymal giant cell astrocytoma -1.656 0.017
Breast cancer -1.900 0.000
lung carcinoma 1.600 0.000
ovarian cancer 1.300 0.026
pituitary cancer -2.700 0.000
Down syndrome 1.300 0.005

Synonym

Accession Q9NZH0 D2DFB0 O75205 Q8NBZ8
Symbols RAIG2
RAIG-2

Gene

PANTHER Protein Class (2)

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model
Steve Finkbeiner Neurite and survival phenotype identified

Gene RIF (3)

PMID Text
24404583 this study proposes that increased expression of GPRC5B contributes to the reduced insulin secretion and beta-cell viability observed in type-2 diabetes.
20935630 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALIT      1 - 70
LLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCL     71 - 140
LSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVL    141 - 210
LVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASG    211 - 280
WVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGF    281 - 350
PNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW                     351 - 403
//

Text Mined References (23)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24729846 2014 G protein-coupled receptor, family C, group 5 (GPRC5B) downregulation in spinal cord neurons is involved in neuropathic pain.
24412205 2014 Intercellular transfer of GPRC5B via exosomes drives HGF-mediated outward growth.
24404583 2013 GPRC5B a putative glutamate-receptor candidate is negative modulator of insulin secretion.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23169819 2012 GPRC5B activates obesity-associated inflammatory signaling in adipocytes.
21557262 2011 Proteomic identification of exosomal LRG1: a potential urinary biomarker for detecting NSCLC.
More...