Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.44
PubTator Score 5.70

Knowledge Summary

Patent (4,651)

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 9.4e-03
Breast cancer -1.900 5.9e-06
breast carcinoma -1.400 4.2e-05
Down syndrome 1.300 5.2e-03
esophageal adenocarcinoma 1.800 2.4e-02
glioblastoma -1.100 4.2e-02
group 3 medulloblastoma -2.100 4.6e-04
intraductal papillary-mucinous neoplasm ... 1.700 2.5e-02
lung cancer -1.100 4.3e-03
lung carcinoma 1.600 7.4e-15
malignant mesothelioma -2.900 1.5e-08
medulloblastoma, large-cell -3.200 5.8e-06
oligodendroglioma 1.300 1.2e-02
osteosarcoma -1.322 6.1e-03
ovarian cancer 1.300 2.6e-02
pituitary cancer -2.700 6.6e-06
psoriasis -1.100 4.4e-06
subependymal giant cell astrocytoma -1.656 1.7e-02

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALIT      1 - 70
LLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCL     71 - 140
LSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVL    141 - 210
LVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASG    211 - 280
WVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGF    281 - 350
PNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW                     351 - 403
//

Text Mined References (23)

PMID Year Title