Property Summary

NCBI Gene PubMed Count 26
Grant Count 58
R01 Count 22
Funding $11,150,615.25
PubMed Score 36.08
PubTator Score 40.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.340 0.000

Synonym

Accession Q9NYZ4 Q7Z728 Siglec-8
Symbols SAF2
SIGLEC-8
SIGLEC8L

Gene

PDB

2N7A   2N7B  

Gene RIF (19)

PMID Text
26694037 Ligands for Siglec-8 and Siglec-9 may regulate the function of eosinophils, mast cells, neutrophils, and other cells in sinus mucosa.
25747723 Inflammation results in up-regulation of immuneinhibitory Siglec-8 and Siglec-9 sialoglycan ligands on human airways.
23835953 Siglec-8 expression is sensitive to tiotropium and formoterol, indicating that it may be involved in COPD pathogenesis and may influence COPD phenotyping
23684072 In activated eosinophils ligation of Siglec-8 leads to ROS-dependent enhancement of IL-5-induced ERK phosphorylation, which results in a novel mode of biochemically regulated eosinophil cell death.
22683541 Report the development of a sensitive competitive ELISA to detect sSiglec-8 in human serum samples obtained from patients with various forms of eosinophilia.
22324980 Engagement of Siglec-8 on blood eosinophils results in caspase- and mitochondria-dependent apoptosis.
22079334 Eosinophils primed by IL-33 and/or IL-5 in vivo would be expected to display enhanced susceptibility to undergoing Siglec-8-induced apoptosis.
21938510 expressed on eosinophils and basophils from subjects with chronic eosinophilic leukemia, chronic myelogenous leukemia, and on malignant and non-malignant bone marrow mast cells
20237496 Observational study of gene-disease association. (HuGE Navigator)
20087405 The Siglec-8 gene may be a susceptibility locus for asthma.
More...

AA Sequence

MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAG      1 - 70
DRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLN     71 - 140
YKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLT    141 - 210
LTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLR    211 - 280
LVCAVNSNPPARLSWTRGSLTLCPSRSSNPGLLELPRVHVRDEGEFTCRAQNAQGSQHISLSLSLQNEGT    281 - 350
GTSRPVSQVTLAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTE    351 - 420
SWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNH    421 - 490
NPSSKEVRG                                                                 491 - 499
//

Text Mined References (27)

PMID Year Title
26694037 2016 Regulation of airway inflammation by Siglec-8 and Siglec-9 sialoglycan ligand expression.
25747723 2015 Expression of ligands for Siglec-8 and Siglec-9 in human airways and airway cells.
23835953 2013 Siglec-8 in induced sputum of COPD patients.
23684072 2013 Mechanism of Siglec-8-mediated cell death in IL-5-activated eosinophils: role for reactive oxygen species-enhanced MEK/ERK activation.
22683541 2012 Biomarkers of eosinophil involvement in allergic and eosinophilic diseases: review of phenotypic and serum markers including a novel assay to quantify levels of soluble Siglec-8.
22324980 2012 Siglec-8 and Siglec-F, the new therapeutic targets in asthma.
22079334 2012 IL-33 enhances Siglec-8 mediated apoptosis of human eosinophils.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21938510 2011 Developmental, malignancy-related, and cross-species analysis of eosinophil, mast cell, and basophil siglec-8 expression.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
More...