Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.64
PubTator Score 21.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.100 4.9e-03
Astrocytoma, Pilocytic 1.200 1.8e-05
atypical teratoid / rhabdoid tumor 1.400 2.0e-04
colon cancer 2.800 8.5e-03
glioblastoma 1.200 3.2e-04
non primary Sjogren syndrome sicca -1.200 2.4e-02
ovarian cancer 1.500 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.060 2.1e-02
Pick disease -1.200 3.4e-05
primitive neuroectodermal tumor 1.100 2.1e-03
progressive supranuclear palsy -1.200 7.0e-03
subependymal giant cell astrocytoma 1.179 3.5e-02

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLET      1 - 70
VQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVV     71 - 140
IHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEE    141 - 210
ILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKEIY    211 - 280
SDLRDNLTAFQKYLIESNKQMMPLKVWELQDLSFQAASQIMSAPVYDSIKLMKDISQNFPIKARSLTRIA    281 - 350
VNQHMREEIKENQKDLQVRFKIQPGDARLFINGLRVDMDVYDAFSILDMLKLEGKMMNGLRNLGINGEDM    351 - 420
SKFLKLNSHIWEYTYVLDIRHSSIMWINDLENDDLYITWPTSCQKLLKPVFPGSVPSIRRNFHNLVLFID    421 - 490
PAQEYTLDFIKLADVFYSHEVPLRIGFVFILNTDDEVDGANDAGVALWRAFNYIAEEFDISEAFISIVHM    491 - 560
YQKVKKDQNILTVDNVKSVLQNTFPHANIWDILGIHSKYDEERKAGASFYKMTGLGPLPQALYNGEPFKH    561 - 630
EEMNIKELKMAVLQRMMDASVYLQREVFLGTLNDRTNAIDFLMDRNNVVPRINTLILRTNQQYLNLISTS    631 - 700
VTADVEDFSTFFFLDSQDKSAVIAKNMYYLTQDDESIISAVTLWIIADFDKPSGRKLLFNALKHMKTSVH    701 - 770
SRLGIIYNPTSKINEENTAISRGILAAFLTQKNMFLRSFLGQLAKEEIATAIYSGDKIKTFLIEGMDKNA    771 - 840
FEKKYNTVGVNIFRTHQLFCQDVLKLRPGEMGIVSNGRFLGPLDEDFYAEDFYLLEKITFSNLGEKIKGI    841 - 910
VENMGINANNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQENDMFFNVIAIVDPLTREAQK    911 - 980
MAQLLVVLGKIINMKIKLFMNCRGRLSEAPLESFYRFVLEPELMSGANDVSSLGPVAKFLDIPESPLLIL    981 - 1050
NMITPEGWLVETVHSNCDLDNIHLKDTEKTVTAEYELEYLLLEGQCFDKVTEQPPRGLQFTLGTKNKPAV   1051 - 1120
VDTIVMAHHGYFQLKANPGAWILRLHQGKSEDIYQIVGHEGTDSQADLEDIIVVLNSFKSKILKVKVKKE   1121 - 1190
TDKIKEDILTDEDEKTKGLWDSIKSFTVSLHKENKKEKDVLNIFSVASGHLYERFLRIMMLSVLRNTKTP   1191 - 1260
VKFWLLKNYLSPTFKEVIPHMAKEYGFRYELVQYRWPRWLRQQTERQRIIWGYKILFLDVLFPLAVDKII   1261 - 1330
FVDADQIVRHDLKELRDFDLDGAPYGYTPFCDSRREMDGYRFWKTGYWASHLLRRKYHISALYVVDLKKF   1331 - 1400
RRIGAGDRLRSQYQALSQDPNSLSNLDQDLPNNMIYQVAIKSLPQDWLWCETWCDDESKQRAKTIDLCNN   1401 - 1470
PKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL                           1471 - 1516
//

Text Mined References (19)

PMID Year Title