Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
R01 Count 9
Funding $894,810
PubMed Score 12.51
PubTator Score 8.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (4)

PMID Text
22220722 Progression of retinal degeneration in Rdh8-deficient Abca4-deficient mice is affected by differential vulnerability of rods and cones to light.
21043051 Our family- and population-based data both suggest that the RDH8 gene is unlikely to be associated with high myopia in Chinese
21043051 Observational study of gene-disease association. (HuGE Navigator)
15755727 prRDH is an enzyme that catalyzes reduction of all-trans-retinal in the rod outer segment, most noticeably at higher light intensities and prolonged illumination, but is not an essential enzyme of the retinoid cycle

AA Sequence

MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSD      1 - 70
ESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVI     71 - 140
SSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDP    141 - 210
ETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRT    211 - 280
THRLLFRCPRLLNLGLQCLSCGCLPTRVRPR                                           281 - 311
//

Text Mined References (13)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
22220722 2012 Retinal cone and rod photoreceptor cells exhibit differential susceptibility to light-induced damage.
21043051 2010 Investigation of the association between all-trans-retinol dehydrogenase (RDH8) polymorphisms and high myopia in Chinese.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
15755727 2005 Role of photoreceptor-specific retinol dehydrogenase in the retinoid cycle in vivo.
15322982 2004 Retinal dehydrogenase 12 (RDH12) mutations in leber congenital amaurosis.
15028754 2004 An outer segment localization signal at the C terminus of the photoreceptor-specific retinol dehydrogenase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12226107 2002 Dual-substrate specificity short chain retinol dehydrogenases from the vertebrate retina.
More...