Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.61
PubTator Score 5.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 3.7e-04
Breast cancer -2.300 8.9e-08
chronic rhinosinusitis -1.193 2.0e-02
ependymoma 1.600 1.7e-07
group 3 medulloblastoma 1.900 3.1e-03
interstitial cystitis -1.200 1.8e-02
intraductal papillary-mucinous adenoma (... -1.100 3.8e-04
invasive ductal carcinoma -1.100 4.8e-02
malignant mesothelioma -3.900 7.1e-09
osteosarcoma 1.166 2.3e-02
ovarian cancer -2.200 9.2e-17
pediatric high grade glioma 1.100 2.0e-02
psoriasis -1.300 2.7e-05

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMG      1 - 70
NRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLYIMLKGKMGTVNLHQFTGQLT     71 - 140
EELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLFSTNKKKIKEFHQYFQVYDEDFEYGSQLPEC    141 - 210
LLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVP    211 - 280
VAFWTLAYVLSHPDIHKAIMEGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVK    281 - 350
PVEILNYIIPSGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFA    351 - 420
LLEVQMCIILILYKYDCSLLDPLPKQSYLHLVGVPQPEGQCRIEYKQRI                         421 - 469
//

Text Mined References (11)

PMID Year Title