Property Summary

NCBI Gene PubMed Count 7
PubMed Score 12.84
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 1.1e-04
lung cancer 4740 3.4e-04
non primary Sjogren syndrome sicca 891 1.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 3.4e-04
non primary Sjogren syndrome sicca 1.500 1.8e-02
ovarian cancer 1.300 1.1e-04

Synonym

Accession Q9NYJ1 B2RAA0 Q69YU4
Symbols CMC3
E2IG2
CHCHD8

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQA      1 - 70
RRQEELQRRQEQAGAHH                                                          71 - 87
//

Text Mined References (13)

PMID Year Title