Property Summary

NCBI Gene PubMed Count 27
PubMed Score 40.62
PubTator Score 26.38

Knowledge Summary

Patent (3,119)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dentin sensitivity 14 4.283 2.1

Expression

Gene RIF (11)

AA Sequence

MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALG      1 - 70
GGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGD     71 - 140
RLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTL    141 - 210
TTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTG    211 - 280
TVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDES    281 - 350
SDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV                               351 - 393
//

Text Mined References (29)

PMID Year Title