Property Summary

NCBI Gene PubMed Count 26
Grant Count 9
R01 Count 5
Funding $751,415.75
PubMed Score 37.85
PubTator Score 26.38

Knowledge Summary

Patent (3,119)

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (10)

PMID Text
26332952 How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2.
25809865 KCNK4 promoter methylation is associated with Breast Cancer.
25500157 findings uncover a unique aspect of potassium channel modulation, indicate a means for how the channel C-terminal cytoplasmic domain affects the C-type gate, and suggest how lipids and bilayer inner leaflet deformations gate the channel.
24550493 TRAAK is responsive to mechanical forces similar to the ion channel Piezo1; mechanical activation of TRAAK can electrically counter Piezo1 activation.
23341632 structure reveals a domain-swapped chain connectivity enabled by the helical cap that exchanges two opposing outer helices 180 degrees around the channel
22282805 crystal structure of TRAAK at 3.8 angstroms resolution; channel comprises 2 protomers that create 2-fold symmetric K(+) channel; extracellular surface has a helical cap; 2 diagonally opposed gate-forming inner helices form membrane-interacting structures
20811500 role for TREK-1 in contributing to uterine quiescence during gestation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
11042359 Human TASK-3 was cloned and expressed; protein sequence and activity compared to similar two pore domain potassium channels, including KCNK4 (TRAAK).

AA Sequence

MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALG      1 - 70
GGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGD     71 - 140
RLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTL    141 - 210
TTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTG    211 - 280
TVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDES    281 - 350
SDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV                               351 - 393
//

Text Mined References (28)

PMID Year Title
26332952 2015 How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2.
25809865 2015 Racial variation in breast tumor promoter methylation in the Carolina Breast Cancer Study.
25500157 2014 Transmembrane helix straightening and buckling underlies activation of mechanosensitive and thermosensitive K(2P) channels.
25471887 2014 Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
24550493 2014 Mechanosensitivity is mediated directly by the lipid membrane in TRAAK and TREK1 K+ channels.
23341632 2013 Domain-swapped chain connectivity and gated membrane access in a Fab-mediated crystal of the human TRAAK K+ channel.
22837380 2012 A novel sarcoidosis risk locus for Europeans on chromosome 11q13.1.
22282805 2012 Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel.
20811500 2010 Expression of stretch-activated two-pore potassium channels in human myometrium in pregnancy and labor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...