Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $120,179.33
PubMed Score 21.91
PubTator Score 9.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NYG2 Q53A17 Q96BL0
Symbols GODZ
DHHC3
DHHC-3
ZNF373

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
23687301 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
22314500 Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin alpha6beta4.
22240897 GODZ regulates plasma membrane targeting of DR4 and thus TRAIL/DR4-mediated apoptosis in cancer cells.
19955568 Data conclude that GODZ encodes a Ca(2+) transport protein in addition to its ability to palmitoylate protein substrates.

AA Sequence

MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPS      1 - 70
RDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRA     71 - 140
HHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSP    141 - 210
PTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGW    211 - 280
ASPFATPDQGKADPYQYVV                                                       281 - 299
//

Text Mined References (17)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23687301 2013 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22314500 2012 Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin ?6?4.
22240897 2012 Regulation in the targeting of TRAIL receptor 1 to cell surface via GODZ for TRAIL sensitivity in tumor cells.
19955568 2010 Golgi-specific DHHC zinc finger protein GODZ mediates membrane Ca2+ transport.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
More...