Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.91
PubTator Score 9.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 6.40593732134097E-7
atypical teratoid / rhabdoid tumor 4369 3.57827792858932E-5
medulloblastoma, large-cell 6234 5.23087682064228E-5
interstitial cystitis 2299 3.49789198631613E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.58302128899018E-4
group 4 medulloblastoma 1875 8.43908911827181E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00285234480193562

Expression

Synonym

Accession Q9NYG2 Q53A17 Q96BL0
Symbols GODZ
DHHC3
DHHC-3
ZNF373

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
23687301 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
22314500 Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin alpha6beta4.
22240897 GODZ regulates plasma membrane targeting of DR4 and thus TRAIL/DR4-mediated apoptosis in cancer cells.
19955568 Data conclude that GODZ encodes a Ca(2+) transport protein in addition to its ability to palmitoylate protein substrates.

AA Sequence

MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPS      1 - 70
RDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRA     71 - 140
HHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSP    141 - 210
PTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGW    211 - 280
ASPFATPDQGKADPYQYVV                                                       281 - 299
//

Text Mined References (17)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23687301 2013 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22314500 2012 Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin ?6?4.
22240897 2012 Regulation in the targeting of TRAIL receptor 1 to cell surface via GODZ for TRAIL sensitivity in tumor cells.
19955568 2010 Golgi-specific DHHC zinc finger protein GODZ mediates membrane Ca2+ transport.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
More...