Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.44
PubTator Score 9.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (6)

AA Sequence

MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPS      1 - 70
RDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRA     71 - 140
HHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSP    141 - 210
PTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGW    211 - 280
ASPFATPDQGKADPYQYVV                                                       281 - 299
//

Text Mined References (21)

PMID Year Title