Property Summary

NCBI Gene PubMed Count 36
PubMed Score 189.96
PubTator Score 21.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 6.0e-05
Breast cancer -2.600 2.9e-53
dermatomyositis 1.100 9.8e-04
glioblastoma -1.300 4.8e-04
hereditary spastic paraplegia -1.023 4.4e-02
Multiple myeloma 1.309 1.0e-02
osteosarcoma -2.440 1.6e-06
ovarian cancer -2.000 6.4e-05
progressive supranuclear palsy -1.100 1.2e-02
psoriasis 1.200 4.9e-04
Rheumatoid arthritis 1.100 2.9e-02
tuberculosis 1.400 1.2e-05

Gene RIF (19)

AA Sequence

MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRP      1 - 70
YGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPR     71 - 140
SSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSG    141 - 210
DIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNG    211 - 280
SSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLL    281 - 350
DRGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQG    351 - 420
KSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITV    421 - 490
KKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSN    491 - 560
RPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNE    561 - 630
RFTSYQKATEEHSTRQKSPEIHRRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRR    631 - 700
RKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESK    701 - 770
KEREEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYT    771 - 840
PKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEE    841 - 910
KKDRRKEEKE                                                                911 - 920
//

Text Mined References (56)

PMID Year Title