Property Summary

NCBI Gene PubMed Count 32
Grant Count 11
R01 Count 7
Funding $3,629,063.67
PubMed Score 173.43
PubTator Score 21.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.029
Multiple myeloma 1.309 0.010
psoriasis 1.200 0.000
osteosarcoma -2.440 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.300 0.000
hereditary spastic paraplegia -1.023 0.044
tuberculosis and treatment for 6 months 1.900 0.000
progressive supranuclear palsy -1.100 0.012
Breast cancer -2.600 0.000
ovarian cancer -2.000 0.000
dermatomyositis 1.100 0.001

Gene RIF (15)

PMID Text
26183150 both cytoplasmic BCLAF1 expression and nuclear BCLAF1 expression are increased in post-neoadjuvant therapy rectal cancer, and that negative and weak nuclear BCLAF1 expression are independently associated with a poor prognosis
25091051 SRSF10 is a key regulator of BCLAF1 pre-mRNA splicing and the maintenance of oncogenic features in human colon cancer cells
24389646 findings showed that FXR1P interacts with BTF in vivo and proved that FXR1P and BTF can co-localize mainly in the cytoplasm around the nucleus
23778535 BTF has functions distinct from TRAP150 in regulating the subcellular distribution of mRNAs in human cells.
23364796 HIV-1 Tat upregulates the expression of BCL2-associated transcription factor 1 (BCLAF1) in Jurkat cells
22833098 BCLAF1 co-localized with gammaH2AX foci in nuclei and stabilized the Ku70/DNA-PKcs complex therein, facilitating non-homologous end joining (NHEJ)-based DSB repair in surviving cells.
22645331 In the absence of BclAF1 neutralization, viral gene expression and replication are inhibited. These data identify two temporally and mechanistically distinct functions used by human cytomegalovirus to down-regulate a cellular antiviral protein
21454709 Sirt1 negatively regulates T cell activation via H3K56 deacetylation at the promoter region to inhibit transcription of Bclaf1
20855536 We replicated the association of BCL2L11 and CASP9 with non-Hodgkin's lymphoma risk at the gene and SNP level, and identified novel associations with BCLAF1 and BAG5.
20855536 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRP      1 - 70
YGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPR     71 - 140
SSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSG    141 - 210
DIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNG    211 - 280
SSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLL    281 - 350
DRGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQG    351 - 420
KSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITV    421 - 490
KKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSN    491 - 560
RPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNE    561 - 630
RFTSYQKATEEHSTRQKSPEIHRRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRR    631 - 700
RKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESK    701 - 770
KEREEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYT    771 - 840
PKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEE    841 - 910
KKDRRKEEKE                                                                911 - 920
//

Text Mined References (51)

PMID Year Title
26183150 2016 The expression and prognostic significance of bcl-2-associated transcription factor 1 in rectal cancer following neoadjuvant therapy.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25091051 2014 BCLAF1 and its splicing regulator SRSF10 regulate the tumorigenic potential of colon cancer cells.
24389646 2014 Bcl-2-associated transcription factor 1 interacts with fragile X-related protein 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
More...