Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.26
PubTator Score 738.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.600 1.3e-05
atypical teratoid / rhabdoid tumor 1.500 1.2e-02
Breast cancer 1.500 1.6e-03
breast carcinoma 1.500 9.3e-16
cutaneous lupus erythematosus -3.000 1.8e-03
ductal carcinoma in situ 2.500 9.7e-05
fascioscapulohumeral muscular dystrophy -2.630 1.3e-12
glioblastoma 1.500 5.0e-04
intraductal papillary-mucinous neoplasm ... 2.300 7.1e-04
invasive ductal carcinoma 3.000 1.8e-04
medulloblastoma, large-cell 2.500 1.3e-03
non-small cell lung cancer 1.581 1.5e-08
osteosarcoma 1.420 5.6e-03
psoriasis -2.200 5.8e-05

Gene RIF (8)

AA Sequence

MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYP      1 - 70
SYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGE     71 - 140
HEVPVPSYYRASPSYSALDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPS    141 - 210
PNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQT    211 - 280
LELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT            281 - 342
//

Text Mined References (25)

PMID Year Title