Property Summary

NCBI Gene PubMed Count 24
PubMed Score 48.70
PubTator Score 26.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -2.000 0.033
medulloblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -3.000 0.000
pediatric high grade glioma -1.500 0.044

Synonym

Accession Q9NYB5 B7Z251 B7Z3Q3 B7Z8P1 F5GZD6 Q5JPA4
Symbols OATP1
OATPF
OATP-F
OATP14
OATP1C1
OATPRP5
SLC21A14

Gene

PANTHER Protein Class (1)

Gene RIF (11)

PMID Text
25403996 We found a highly significant association between PDE3A-SLCO1C1 and the clinical response to TNF blockers
23651021 The PDE3A-SLCO1C1 locus rs3794271 SNP showed a highly significant association with anti-TNF treatment response.
21508134 The strong expression of MCT10 and OATP1C1 in the human hypothalamus indicates a possible role in the regulation of the hypothalamus-pituitary-thyroid axis.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
19290786 Protein is highly expressed in the intestine, kidney, cholangiocytes and the blood-brain barrier.
18687783 OATP14 mRNA and protein are strongly enriched in mouse and rat cerebral microvessels but not in human microvessels.
18566113 OATP1C1 mediates transport of thyroid hormones and increases the access of these substrates to the intracellular active sites of the deiodinases with no effect of genetic variation
18566113 Observational study of gene-disease association. (HuGE Navigator)
18410547 OATP1C1 polymorphisms are associated with fatigue and depression, but do not explain differences in neurocognitive functioning or appreciation of LT4-LT3 combination therapy.
18410547 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAEGYLKSTITQI      1 - 70
ERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMGVGTLLIAMPQFFMEQYKYER     71 - 140
YSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEVDTSSSMWIYVFLGNLLRGIGETPIQPLGIA    141 - 210
YLDDFASEDNAAFYIGCVQTVAIIGPIFGFLLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLI    211 - 280
AGIISLLAAVPFWYLPKSLPRSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLF    281 - 350
GNPVYFLYLCTSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS    351 - 420
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRCKCSETKWEPM    421 - 490
CGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGRCQKDNGCPQMFLYFLVISVI    491 - 560
TSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLAGIPAPVYFGVLIDTSCLKWGFKRCGSRGSC    561 - 630
RLYDSNVFRHIYLGLTVILGTVSILLSIAVLFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLL    631 - 700
QPNYWPGKETQL                                                              701 - 712
//

Text Mined References (27)

PMID Year Title
25403996 2015 Association of the PDE3A-SLCO1C1 locus with the response to anti-TNF agents in psoriasis.
23651021 2013 GWAS replication study confirms the association of PDE3A-SLCO1C1 with anti-TNF therapy response in rheumatoid arthritis.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
21508134 2011 Expression of thyroid hormone transporters in the human hypothalamus.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19290786 2009 Pharmacogenetics of the organic anion transporting polypeptide 1A2.
19179441 2009 Minireview: Pathophysiological importance of thyroid hormone transporters.
19129463 2009 Mechanisms of pH-gradient driven transport mediated by organic anion polypeptide transporters.
18845642 2009 Competitive inhibition of organic anion transporting polypeptide 1c1-mediated thyroxine transport by the fenamate class of nonsteroidal antiinflammatory drugs.
More...