Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.07
PubTator Score 4.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.900 0.000

Synonym

Accession Q9NYA3 A8K959 Q9NYA7
Symbols GLP
GOLGA6

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MWPQPYLPPHPMMLEESRQNKLAAAKKKLKEYQQRKSPGIPAGAKTKKKKTDSSPETTTSGGCHSPGDSQ      1 - 70
YQELAVALESSSVTISQLNENIESLKQQKKQVEHQLEEAKKTNNEIHKAQMERLETINILTLEKADLKTT     71 - 140
LYHTKRAARHFEEESKDLAGRLQYSLQRIQELERALCAVSTQQQEEDRSSSCREAVLQRWLQQTIKERAL    141 - 210
LNAHVTQVTESLKQVQLERDEYAKHIKGERARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKN    211 - 280
QMAEPPSLAPPAVTSVVEQLQDEAKHLRQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQE    281 - 350
AQRVREQERLCEQNERLREQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKE    351 - 420
ERLQKQEERLALSQNHKLDKQLAEPQCSFEDLNNEKKSALQLEQQVKELQEKLDEEHLEAASHQNQQLET    421 - 490
QLSLVALPGEGDGGQHLDSEEEEAPRPTPNIPEDLESREATSSFMDLPKEKADGTEQVERRELGFVQPSG    491 - 560
VTDGMRESFTVYESQGAVPNTRHQEMEDVIRLAQKEEEMKVKLLELQELVLPLVGNHEGHGKFLIAAQNP    561 - 630
ADEPTPGAPAPQELGAAGEQDVFYEVSLDNNVEPAPGAAREGSPHDNPTVQQIVQLSPVMQDT           631 - 693
//

Text Mined References (9)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12915487 2003 Neocentromeres in 15q24-26 map to duplicons which flanked an ancestral centromere in 15q25.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896453 2002 Human chromosome 15q11-q14 regions of rearrangements contain clusters of LCR15 duplicons.
11509185 2001 A polymorphic genomic duplication on human chromosome 15 is a susceptibility factor for panic and phobic disorders.
11161787 2000 Cloning and characterization of a Golgin-related gene from the large-scale polymorphism linked to the PML gene.
11156619 2001 Additional complexity on human chromosome 15q: identification of a set of newly recognized duplicons (LCR15) on 15q11-q13, 15q24, and 15q26.