Property Summary

NCBI Gene PubMed Count 6
PubMed Score 34.83
PubTator Score 20.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -2.200 4.5e-02
cutaneous lupus erythematosus -1.100 2.1e-03
intraductal papillary-mucinous adenoma (... -1.100 1.8e-03
intraductal papillary-mucinous carcinoma... -1.100 1.5e-03
lung carcinoma 1.500 3.3e-11
psoriasis -1.200 1.0e-03

Gene RIF (4)

AA Sequence

MGTEGPPPPAASRGRQGCLLVPARTKTTIALLYDEESENAYDIRLKLTKEVLTIQKQDVVCVGGSHQGRN      1 - 70
RRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFEDQAADQTGMLFVGDAVLQVNGIHVENATHEEVVHL     71 - 140
LRNAGDEVTITVEYLREAPAFLKLPLGSPGPSSDHSSGASSPLFDSGLHLNGNSSTTAPSSPSSPIAKDP    141 - 210
RYEKRWLDTLSVPLSMARISRYKAGTEKLRWNAFEVLALDGVSSGILRFYTAQDGTDWLRAVSANIRELT    211 - 280
LQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALKGPSFYVFSTPPVSTFDWVRAERTYHL    281 - 350
CEVLFKVHKFWLTEDCWLQANLYLGLQDFDFEDQRPYCFSIVAGHGKSHVFNVELGSELAMWEKSFQRAT    351 - 420
FMEVQRTGSRTYMCSWQGEMLCFTVDFALGFTCFESKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDT    421 - 490
KQIETKELEFQDLRAVLHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS                         491 - 539
//

Text Mined References (8)

PMID Year Title