Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
Funding $108,110
PubMed Score 34.37
PubTator Score 20.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (4)

PMID Text
23061379 MYT1L and the SNTG2 genes within the reported region could probably relate to the phenotypic discordance of the monozygotic twins.
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntrophin
17292328 A de novo binding partner of X-linked neuroligin 4 and neuroligin 3, which correlates with autism-related mutations.
12429735 role in regulating SCN5A gating by a PDZ domain-mediated interaction

AA Sequence

MGTEGPPPPAASRGRQGCLLVPARTKTTIALLYDEESENAYDIRLKLTKEVLTIQKQDVVCVGGSHQGRN      1 - 70
RRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFEDQAADQTGMLFVGDAVLQVNGIHVENATHEEVVHL     71 - 140
LRNAGDEVTITVEYLREAPAFLKLPLGSPGPSSDHSSGASSPLFDSGLHLNGNSSTTAPSSPSSPIAKDP    141 - 210
RYEKRWLDTLSVPLSMARISRYKAGTEKLRWNAFEVLALDGVSSGILRFYTAQDGTDWLRAVSANIRELT    211 - 280
LQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALKGPSFYVFSTPPVSTFDWVRAERTYHL    281 - 350
CEVLFKVHKFWLTEDCWLQANLYLGLQDFDFEDQRPYCFSIVAGHGKSHVFNVELGSELAMWEKSFQRAT    351 - 420
FMEVQRTGSRTYMCSWQGEMLCFTVDFALGFTCFESKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDT    421 - 490
KQIETKELEFQDLRAVLHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS                         491 - 539
//

Text Mined References (8)

PMID Year Title
23061379 2013 Monozygotic twins discordant for submicroscopic chromosomal anomalies in 2p25.3 region detected by array CGH.
17292328 2007 Neuroligins 3 and 4X interact with syntrophin-gamma2, and the interactions are affected by autism-related mutations.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429735 2003 Syntrophin gamma 2 regulates SCN5A gating by a PDZ domain-mediated interaction.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10747910 2000 Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells.