Property Summary

NCBI Gene PubMed Count 6
PubMed Score 34.37
PubTator Score 20.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 3.30363927741265E-11
psoriasis 6685 0.00100024973828942
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00148031747263831
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00184450031473019
cutaneous lupus erythematosus 1056 0.00208175975865897
Breast cancer 3099 0.0447194672761596
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (6)

Synonym

Accession Q9NY99 Q05AH5 G2SYN
Symbols SYN5
G2SYN

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (4)

PMID Text
23061379 MYT1L and the SNTG2 genes within the reported region could probably relate to the phenotypic discordance of the monozygotic twins.
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntrophin
17292328 A de novo binding partner of X-linked neuroligin 4 and neuroligin 3, which correlates with autism-related mutations.
12429735 role in regulating SCN5A gating by a PDZ domain-mediated interaction

AA Sequence

MGTEGPPPPAASRGRQGCLLVPARTKTTIALLYDEESENAYDIRLKLTKEVLTIQKQDVVCVGGSHQGRN      1 - 70
RRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFEDQAADQTGMLFVGDAVLQVNGIHVENATHEEVVHL     71 - 140
LRNAGDEVTITVEYLREAPAFLKLPLGSPGPSSDHSSGASSPLFDSGLHLNGNSSTTAPSSPSSPIAKDP    141 - 210
RYEKRWLDTLSVPLSMARISRYKAGTEKLRWNAFEVLALDGVSSGILRFYTAQDGTDWLRAVSANIRELT    211 - 280
LQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALKGPSFYVFSTPPVSTFDWVRAERTYHL    281 - 350
CEVLFKVHKFWLTEDCWLQANLYLGLQDFDFEDQRPYCFSIVAGHGKSHVFNVELGSELAMWEKSFQRAT    351 - 420
FMEVQRTGSRTYMCSWQGEMLCFTVDFALGFTCFESKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDT    421 - 490
KQIETKELEFQDLRAVLHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS                         491 - 539
//

Text Mined References (8)

PMID Year Title
23061379 2013 Monozygotic twins discordant for submicroscopic chromosomal anomalies in 2p25.3 region detected by array CGH.
17292328 2007 Neuroligins 3 and 4X interact with syntrophin-gamma2, and the interactions are affected by autism-related mutations.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429735 2003 Syntrophin gamma 2 regulates SCN5A gating by a PDZ domain-mediated interaction.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10747910 2000 Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells.