Property Summary

NCBI Gene PubMed Count 43
Grant Count 1
Funding $1,309,843
PubMed Score 95.91
PubTator Score 74.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.026 0.033
non-small cell lung cancer 1.240 0.000
lung cancer 1.200 0.003
breast carcinoma 1.200 0.000
Breast cancer 1.400 0.000
ductal carcinoma in situ 1.200 0.002
invasive ductal carcinoma 2.000 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9NY33 B2RDB5 B4DLX4 F5H8L6 O95748 Q969H2 Q9BV67 Q9HAL6
Symbols DPPIII

Gene

PANTHER Protein Class (3)

 Grant Application (1)

PDB

3FVY   3T6B   3T6J   5E2Q   5E33   5E3A   5E3C   5EGY   5EHH  

Gene RIF (11)

PMID Text
26334575 the DPP III conformational landscape and the influence of ligand binding on the protein structure and dynamics, was investigated.
25581752 Kinetic studies revealed that the single mutant D496G lost selectivity due to the increase of the Km value. The D496G, but not S504G, showed significantly decreased binding of peptides with N-terminal arginine, and of tynorphin.
25192149 The study used three different conformations of human dipeptidyl-peptidase III (DPP III) to investigate the influence of the protein environment on ligand binding and the Zn(2+) coordination.
24472318 Deletion/mutagenesis of C/EBP-beta binding motif of DPP III promoter significantly increased its activity and abolished its responsiveness to IL-6 in glioblastoma cells.
23667907 Combined results of mutational analysis and mass spectrometry suggest that glutathionylation (formation of mixed disulfide) of Cys176 and Cys654 contributes to human DPP III inactivation by oxidized glutathione.
23382044 Amplification and mRNA overexpression of the DPP3 gene is associated with squamous cell lung carcinomas.
23362197 The activity of the yeast and human dipeptidyl peptidase III were examined.
22493238 results provide the basis for the design of specific inhibitors that enable the elucidation of the exact role of DPP III and the exploration of its potential as a target of pain intervention strategies
20236318 Ets-1/Elk-1 is a critical mediator of DPP3 transcription in human glioblastoma cells.
18163885 the conserved tyrosine could be involved in transition state stabilization during the catalytic action of M49 peptidases.
More...

AA Sequence

MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQ      1 - 70
DPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEV     71 - 140
RGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKP    141 - 210
YYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQ    211 - 280
YIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASA    281 - 350
EQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ    351 - 420
REKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYR    421 - 490
SGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPE    491 - 560
AFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKS    561 - 630
TGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSF    631 - 700
SERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA                                     701 - 737
//

Text Mined References (48)

PMID Year Title
26334575 2015 Molecular simulations reveal that the long range fluctuations of human DPP III change upon ligand binding.
25581752 2015 Aspartate 496 from the subsite S2 drives specificity of human dipeptidyl peptidase III.
25416956 2014 A proteome-scale map of the human interactome network.
25192149 2014 Hunting the human DPP III active conformation: combined thermodynamic and QM/MM calculations.
24472318 2014 Transcription factor C/EBP-? mediates downregulation of dipeptidyl-peptidase III expression by interleukin-6 in human glioblastoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667907 2012 Molecular determinants of human dipeptidyl peptidase III sensitivity to thiol modifying reagents.
23382044 2013 Proteomic analysis of ubiquitin ligase KEAP1 reveals associated proteins that inhibit NRF2 ubiquitination.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362197 2013 Hydrolysis of dipeptide derivatives reveals the diversity in the M49 family.
More...