Property Summary

NCBI Gene PubMed Count 47
PubMed Score 105.70
PubTator Score 74.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.400 1.1e-18
breast carcinoma 1.200 2.0e-32
ductal carcinoma in situ 1.200 1.8e-03
invasive ductal carcinoma 2.000 2.9e-04
lung cancer 1.200 3.4e-03
non-small cell lung cancer 1.240 4.3e-22
osteosarcoma -1.026 3.3e-02
ovarian cancer 1.600 1.1e-05

Gene RIF (15)

AA Sequence

MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQ      1 - 70
DPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEV     71 - 140
RGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKP    141 - 210
YYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQ    211 - 280
YIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASA    281 - 350
EQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ    351 - 420
REKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYR    421 - 490
SGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPE    491 - 560
AFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKS    561 - 630
TGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSF    631 - 700
SERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA                                     701 - 737
//

Text Mined References (53)

PMID Year Title