Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.38
PubTator Score 4.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.177 3.0e-04
atypical teratoid/rhabdoid tumor 1.100 1.7e-04
glioblastoma -1.100 3.8e-05
osteosarcoma -1.468 9.5e-04
ovarian cancer -1.600 5.8e-04
pancreatic cancer 1.100 1.8e-02
pancreatic ductal adenocarcinoma liver m... -1.353 1.6e-02
pediatric high grade glioma 1.100 2.2e-04

Protein-protein Interaction (6)

Gene RIF (4)

AA Sequence

MDVERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGP      1 - 70
PNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCVYPSSE     71 - 140
KNNSNSLNRMNGVMFPGNSPSYTERSNINGPGTPRPLNRPKVSLSAPMTTNGLPESTDSKEANLQQNEEK    141 - 210
NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASS    211 - 280
SSQDKDKDSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNEETSEENNQMEESD    281 - 350
VSQAEKDLLHSEGSENEGPVSSSSSDCRETEELVGSNSSKTGEILSESSMENDDEATEVTDEPMEQD       351 - 417
//

Text Mined References (26)

PMID Year Title