Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.88
PubTator Score 4.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.468 0.001
glioblastoma -1.100 0.000
acute quadriplegic myopathy 1.177 0.000
pancreatic ductal adenocarcinoma liver m... -1.353 0.016
pediatric high grade glioma 1.100 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
ovarian cancer -1.600 0.001
pancreatic cancer 1.100 0.018

Synonym

Accession Q9NY27 A8K1I6 Q2TAJ9 Q498B8 Q8WXX6
Symbols PP4R2

Gene

Gene RIF (3)

PMID Text
22559936 PPP4R2 affects the survival of neuronal cells in response to DNA damage.
20154705 PP4R2, a regulatory subunit of PP4, mediates the DNA damage-dependent association between RPA2 and the PP4C catalytic subunit.
18614045 A three-protein PP4 phosphatase complex in mammalian cells, containing PP4C, PP4R2, and PP4R3beta, specifically dephosphorylates ATR-mediated gamma-H2AX generated during DNA replication.

AA Sequence

MDVERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGP      1 - 70
PNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCVYPSSE     71 - 140
KNNSNSLNRMNGVMFPGNSPSYTERSNINGPGTPRPLNRPKVSLSAPMTTNGLPESTDSKEANLQQNEEK    141 - 210
NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASS    211 - 280
SSQDKDKDSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNEETSEENNQMEESD    281 - 350
VSQAEKDLLHSEGSENEGPVSSSSSDCRETEELVGSNSSKTGEILSESSMENDDEATEVTDEPMEQD       351 - 417
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26194823 2015 Dephosphorylation of DBC1 by Protein Phosphatase 4 Is Important for p53-Mediated Cellular Functions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22732494 2012 Protein phosphatase PP4 is involved in NHEJ-mediated repair of DNA double-strand breaks.
22559936 2012 PPP4R2 regulates neuronal cell differentiation and survival, functionally cooperating with SMN.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20154705 2010 A PP4 phosphatase complex dephosphorylates RPA2 to facilitate DNA repair via homologous recombination.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...