Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
R01 Count 2
Funding $118,108.34
PubMed Score 62.74
PubTator Score 610.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
26252478 ADAM2, CALR3 and SAGE1 cancer/testis antigens are not promising targets for immunotherapy of breast and lung cancer.
16061876 MAGE-A4(143-151) and SAGE(715-723) are HLA-A2402-restricted CTL epitopes

AA Sequence

MQASPLQTSQPTPPEELHAAAYVFTNDGQQMRSDEVNLVATGHQSKKKHSRKSKRHSSSKRRKSMSSWLD      1 - 70
KQEDAAVTHSICEERINNGQPVADNVLSTAPPWPDATIAHNIREERMENGQSRTDKVLSTAPPQLVHMAA     71 - 140
AGIPSMSTRDLHSTVTHNIREERMENGQPQPDNVLSTGPTGLINMAATPIPAMSARDLYATVTHNVCEQK    141 - 210
MENVQPAPDNVLLTLRPRRINMTDTGISPMSTRDPYATITYNVPEEKMEKGQPQPDNILSTASTGLINVA    211 - 280
GAGTPAISTNGLYSTVPHNVCEEKMENDQPQPNNVLSTVQPVIIYLTATGIPGMNTRDQYATITHNVCEE    281 - 350
RVVNNQPLPSNALSTVLPGLAYLATADMPAMSTRDQHATIIHNLREEKKDNSQPTPDNVLSAVTPELINL    351 - 420
AGAGIPPMSTRDQYATVNHHVHEARMENGQRKQDNVLSNVLSGLINMAGASIPAMSSRDLYATITHSVRE    421 - 490
EKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERMENNQPQPSYDLSTVLPGLTY    491 - 560
LTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFSTVPPAFINMAATGVSSMSTRDQYAAVTHNIR    561 - 630
EEKINNSQPAPGNILSTAPPWLRHMAAAGISSTITRDLYVTATHSVHEEKMTNGQQAPDNSLSTVPPGCI    631 - 700
NLSGAGISCRSTRDLYATVIHDIQEEEMENDQTPPDGFLSNSDSPELINMTGHCMPPNALDSFSHDFTSL    701 - 770
SKDELLYKPDSNEFAVGTKNYSVSAGDPPVTVMSLVETVPNTPQISPAMAKKINDDIKYQLMKEVRRFGQ    771 - 840
NYERIFILLEEVQGSMKVKRQFVEFTIKEAARFKKVVLIQQLEKALKEIDSHCHLRKVKHMRKR          841 - 904
//

Text Mined References (8)

PMID Year Title
26252478 2015 Lack of ADAM2, CALR3 and SAGE1 Cancer/Testis Antigen Expression in Lung and Breast Cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16061876 2005 Determination of cellularly processed HLA-A2402-restricted novel CTL epitopes derived from two cancer germ line genes, MAGE-A4 and SAGE.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10919659 2000 Identification on a human sarcoma of two new genes with tumor-specific expression.