Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.07
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MAAAAAETPEVLRECGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVGTEESDFEGWAFPF      1 - 70
PGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKLKTEGFCGLPSFSREVVRRMG     71 - 140
LYPGLEGFRPVEQCNLDYCPERGSAIDPHLDDAWLWGERLVSLNLLSPTVLSMCREAPGSLLLCSAPSAA    141 - 210
PEALVDSVIAPSRSVLCQEVEVAIPLPARSLLVLTGAARHQWKHAIHRRHIEARRVCVTFRELSAEFGPG    211 - 280
GRQQELGQELLRIALSFQGRPV                                                    281 - 302
//

Text Mined References (17)

PMID Year Title