Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.01
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NXW9 Q53H92 Q9H6A4
Symbols ABH4

Gene

  Ortholog (10)

Pathway (1)

Gene RIF (3)

PMID Text
23673617 ALKBH4-dependent actin demethylation regulates actomyosin function by promoting actin-non-muscle myosin II interaction.
23145062 The regions mediating binding to ALKBH4 comprised domains previously reported to be involved in interaction with DNA or chromatin.
21166655 ALKBH4 represents an active Fe(II)/2OG-dependent decarboxylase and suggest that the cysteine cluster is involved in processes other than Fe co-ordination.

AA Sequence

MAAAAAETPEVLRECGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVGTEESDFEGWAFPF      1 - 70
PGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKLKTEGFCGLPSFSREVVRRMG     71 - 140
LYPGLEGFRPVEQCNLDYCPERGSAIDPHLDDAWLWGERLVSLNLLSPTVLSMCREAPGSLLLCSAPSAA    141 - 210
PEALVDSVIAPSRSVLCQEVEVAIPLPARSLLVLTGAARHQWKHAIHRRHIEARRVCVTFRELSAEFGPG    211 - 280
GRQQELGQELLRIALSFQGRPV                                                    281 - 302
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23673617 2013 ALKBH4-dependent demethylation of actin regulates actomyosin dynamics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21166655 2011 Spectroscopic and magnetic studies of wild-type and mutant forms of the Fe(II)- and 2-oxoglutarate-dependent decarboxylase ALKBH4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...