Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
Funding $185,811.83
PubMed Score 3.01
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NXW9 Q53H92 Q9H6A4
Symbols ABH4

Gene

Gene RIF (3)

PMID Text
23673617 ALKBH4-dependent actin demethylation regulates actomyosin function by promoting actin-non-muscle myosin II interaction.
23145062 The regions mediating binding to ALKBH4 comprised domains previously reported to be involved in interaction with DNA or chromatin.
21166655 ALKBH4 represents an active Fe(II)/2OG-dependent decarboxylase and suggest that the cysteine cluster is involved in processes other than Fe co-ordination.

AA Sequence

MAAAAAETPEVLRECGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVGTEESDFEGWAFPF      1 - 70
PGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKLKTEGFCGLPSFSREVVRRMG     71 - 140
LYPGLEGFRPVEQCNLDYCPERGSAIDPHLDDAWLWGERLVSLNLLSPTVLSMCREAPGSLLLCSAPSAA    141 - 210
PEALVDSVIAPSRSVLCQEVEVAIPLPARSLLVLTGAARHQWKHAIHRRHIEARRVCVTFRELSAEFGPG    211 - 280
GRQQELGQELLRIALSFQGRPV                                                    281 - 302
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23673617 2013 ALKBH4-dependent demethylation of actin regulates actomyosin dynamics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21166655 2011 Spectroscopic and magnetic studies of wild-type and mutant forms of the Fe(II)- and 2-oxoglutarate-dependent decarboxylase ALKBH4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...